1OTK


Conserved Protein Domain Family
PA_CoA_Oxy3

?
TIGR02158: PA_CoA_Oxy3 
Click on image for an interactive view with Cn3D
phenylacetate-CoA oxygenase, PaaI subunit
Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 131213
View PSSM: TIGR02158
Aligned: 6 rows
Threshold Bit Score: 347.177
Threshold Setting Gi: 499198840
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1OTK_A        12 LGDNCLVLSQRLGEWCGHAPELEIDLALANIGLDLLGQARNFLSYAAELAGeGD--EDTLAFTRDERQFSNLLLVEQPNG 89  Escherichia col...
P76079        11 LGDNCLVLSQRLGEWCGHAPELEIDLALANIGLDLLGQARNFLSYAAELAG-EGd-EDTLAFTRDERQFSNLLLVEQPNG 88  Escherichia col...
CAC10608      14 LGDNALILGQRMSEWCGHAPVLEEDMALANMSLDLIGQARMLLTHAGKLEG-KGrdEDQLAFLRTEMHYRNLTLCELPNV 92  Azoarcus evansii
WP_006769652  42 LGDDALMLAQRLGWWISRAPEMEEDIAIGNIALDLVGHARFLYSYAGTAWN-KT--EDDLAYFRDEEEFRSARLTETENG 118 Corynebacterium...
WP_010889010  25 LADDEIVLAHRGGEWTGHAPILEEDIALANIAQDELGHAALYLGLRTDLDG-SQ--PDRLAMFRSASEYTNTRLTELPKG 101 Deinococcus rad...
WP_010896380  27 LADDDYIVAYRGSEWLGLAPHIEEDVAFSSITQNTMGHAVMFYELLEQLGE-GD--ADTLAHERDPALRRNSVYLEKKNG 103 Bacillus halodu...
1OTK_A        90 ----------NFADTIARQYFIDAWHVALFTRLMESRDPQLAAISAKAIKEARYHLRFSRGWLERLGNGTDVSGQKMQQA 159 Escherichia col...
P76079        89 ----------NFADTIARQYFIDAWHVALFTRLMESRDPQLAAISAKAIKEARYHLRFSRGWLERLGNGTDVSGQKMQQA 158 Escherichia col...
CAC10608      93 ----------DFGRTMVRNFLFASLQVLLWERLLASSDTELAAIAAKSLKEARYHAQHAGDWVVRLGDGTAESHERAQAA 162 Azoarcus evansii
WP_006769652 119 ----------DFGQTIARQLLMSHYFLGLYTALENSTDETLAAIAAKAVKEIEYHADHANQWTLRLGLGTEESHRRISEG 188 Corynebacterium...
WP_010889010 102 ----------DWAVTMVRQFLYDAYEALWLEEAGSSRYAPLAEVAHKALREEKFHLQHTALWVERLALGTEESERRTQTA 171 Deinococcus rad...
WP_010896380 104 sgtyldephyDWALTVIRHFFYETFKKIRLEALTQSSYVPLAKAAQRVLMEQPYHLAHWKTWLCQLQQSTEEAKNRLMER 183 Bacillus halodu...
1OTK_A       160 INKLWRFTAELFDADEIDIALSEEGIAVDPRTLRAAWEAEVFAGIN-EATLNVPQEQAYRTGGKKGLHTEHLGPMLAEMQ 238 Escherichia col...
P76079       159 INKLWRFTAELFDADEIDIALSEEGIAVDPRTLRAAWEAEVFAGIN-EATLNVPQEQAYRTGGKKGLHTEHLGPMLAEMQ 237 Escherichia col...
CAC10608     163 LDYLWPYTAEFFAANPTDEAIAAAGIGPAWSELEAAWEAVVVPVLN-EATLTVPARTPFKSYGKFGRHSEHLGHLLSEIE 241 Azoarcus evansii
WP_006769652 189 LYYMWPYVAELFEDLPIHTKLAETGEAVLPSSLWDEFHRNISYVLE-EAGLEIPQVPFARSSQRTGKYNEYRGYILAEMQ 267 Corynebacterium...
WP_010889010 172 LNELWSHAAQLFQPVAGEEELIAAGIVPDPAALKARWEKLVTAHLQgKCGLTLPRGTFTSDDRGRDHHTEYLAPLLAEMQ 251 Deinococcus rad...
WP_010896380 184 IDEAWLEILDMLELGLKGGEMVEYQLITDEATIQQQWVKEMNKSLFyVPSQSLQKQ---EGNGRNGEHTDDLQQALSTCS 260 Bacillus halodu...
1OTK_A       239 YLQRVLPGQQW 249 Escherichia coli K-12
P76079       238 YLQRVLPGQQW 248 Escherichia coli K-12
CAC10608     242 YLQRTYPGAQW 252 Azoarcus evansii
WP_006769652 268 SLARRHPGATW 278 Corynebacterium efficiens
WP_010889010 252 EVARQHPDAEv 262 Deinococcus radiodurans
WP_010896380 261 EVYNSDRHAVW 271 Bacillus halodurans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap