Conserved Protein Domain Family
PA_CoA_Oxy1

?
TIGR02156: PA_CoA_Oxy1 
phenylacetate-CoA oxygenase, PaaG subunit
Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 131211
View PSSM: TIGR02156
Aligned: 5 rows
Threshold Bit Score: 518.633
Threshold Setting Gi: 499198838
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAG28968      29 FDAKIDAGGYIEAKDWMPEAYRKTLVRQISQHAHSEIVGMLPEGNWITRAPTLKRKAILLAKVQDEGGHGLYLYAAAETL 108 Azoarcus evansii
AAC24334      26 FQEKIDAEIKIEAKNWMPEAYRQTLIRQISQHAHSEIVGMLPEGNWVTRAPSLKRKLQLMAKIQDEAGHGLYLYSAMETL 105 Pseudomonas putida
BAC48156      27 FQARIDAEERIEPNDWMPAAYRKTLTRQISQHAHSEIVGMLPEGNWITRAPTLRRKAALLAKVQDECGHGLYLYAAAETL 106 Bradyrhizobium ...
WP_027480070  13 FEARIARGEKIEPGDWMPAEYRRQLIRMISQHAHSEVVGMLPEGEWIARAPSLKRKTILMAKVQDEAGHGQYLYHAAETL 92  Deinococcus rad...
WP_010896378  24 FMEKIDSGKKIEADDWMPKDYRETLIKLISMHGISEIMGALPEKEWVPKAPTLYRKLGIMAKVQDEMGHGQLLLRVAEDL 103 Bacillus halodu...
AAG28968     109 ----GVSRDELLDALHTGKAKYSSIFNYPTLTWADIGVIGWLVDGAAIMNQIPLCKCSYGPYARAMVRICKEESFHQRQG 184 Azoarcus evansii
AAC24334     106 ----GADRDEEIAKLHSGKAKYSSIFNYPTLSWADMGAVGWLVDGAAIVNQVVLQRTSYGPYSRAMVRICKEESFHQRQG 181 Pseudomonas putida
BAC48156     107 ----GASREELVDAMLAGKAKYSSIFNYPTLTWADIGTIGWLVDGAAIMNQIPLCRCSYGPYARAMIRVCKEESFHQRQG 182 Bradyrhizobium ...
WP_027480070  93 ----GVTREEMLDALLTRKAKYSSIFNYPTLTWADVGMIGWLVDGAAIKNQTMLAGCSYGPYSRAMVRICSEETFHHKQG 168 Deinococcus rad...
WP_010896378 104 lapyGKGREDLMIDLLNGDLKFHNVFHMETKTWADAGVIGWLVDGAAIISQTNMLDASYGPYQRALQRICAEEVFHAQHG 183 Bacillus halodu...
AAG28968     185 YDLLLTMMK-GTQEQREMVQDAVNRWWWPSIMMFGPHDKDSVHSGQ---SARWGIKRISNDDLRQKFVDATVKQAEVLGV 260 Azoarcus evansii
AAC24334     182 YEILLTMMRhGTQAQRDMVQDAINRLWWPSLMMFGPSDEHSPNSAQ---SMAWKIKRQTNDELRQRFIDQTVPQLELLGC 258 Pseudomonas putida
BAC48156     183 YEIMLTLCR-GSDEQKAMAQDALNRWWWPVLMMFGPPDATSQHSDT---STKWKIKRFSNDELRQKFVDATVPQAQYLGL 258 Bradyrhizobium ...
WP_027480070 169 KEMMVLYAQ-GTPEQRQMAQDALNRWWWPAVQMLGPHDSDSPNTGA---LSKWGIKLKTNDEVRQEFINEHVPELLEAGL 244 Deinococcus rad...
WP_010896378 184 EAIIMALAE-GTETQRQMLQEALNRWWPALLMFFGPESAETTGSSKqevTTKYKIRKNSNEELRQAFLDKYLPRVFSLGL 262 Bacillus halodu...
AAG28968     261 TMPDPELKWNEERGHYDFGAIDWDEFWNVVNGHGQGNVDRLAARVKAWEDGAWVREA 317 Azoarcus evansii
AAC24334     259 TAPDPELKWNAERGHYDFGEIQWDEFYEVIKGNGPCNQERVATRRKAIEDGAWVREA 315 Pseudomonas putida
BAC48156     259 TIPDPGMTQDAE-GHWRYSEIDWTEFKQVLAGNGPCNRDRMAARRKAHEEGAWVREA 314 Bradyrhizobium diazoefficiens USDA 110
WP_027480070 245 TIPDPDLHQDEA-GNWVHGPIDWSEFWAVIKGEQGLGNERLATRQAAQDEGAWVREA 300 Deinococcus radiodurans
WP_010896378 263 TVPDETLYYNEDEKRWVYQQPNWNEFKQIIRNNGPRSKERLRLRKLAHEKNKWVREA 319 Bacillus halodurans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap