Conserved Protein Domain Family
PA_CoA_ligase

?
TIGR02155: PA_CoA_ligase 
phenylacetate-CoA ligase
Phenylacetate-CoA ligase (PA-CoA ligase) catalyzes the first step in aromatic catabolism of phenylacetic acid (PA) into phenylacetyl-CoA (PA-CoA). Often located in a conserved gene cluster with enzymes involved in phenylacetic acid activation (paaG/H/I/J), phenylacetate-CoA ligase has been found among the proteobacteria as well as in gram positive prokaryotes. In the B-subclass proteobacterium Azoarcus evansii, phenylacetate-CoA ligase has been shown to be induced under aerobic and anaerobic growth conditions. It remains unclear however, whether this induction is due to the same enzyme or to another isoenzyme restricted to specific anaerobic growth conditions. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 131210
View PSSM: TIGR02155
Aligned: 5 rows
Threshold Bit Score: 766.291
Threshold Setting Gi: 499191975
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAF26285      15 EKASQDELRALQLERLKWSVRHAYENVPHYRKAFDAKGVHPDDLKSLADLAKFPFTAKGDLRDNYPFGMFAVPREKVARV 94  Azoarcus evansii
BAC48162      40 ERASRDEIMALQKQRLGWSLKHAYDNVAHYRKAFDKAGVHPSDFRELSDLAKFPFTVKTDLRDNYPFNMFAVPREKLVRV 119 Bradyrhizobium ...
P76085        11 ETASVDELQALQTQRLKWTLKHAYENVPMYRRKFDAAGVHPDDFRELSDLRKFPCTTKQDLRDNYPFDTFAVPMEQVVRI 90  Escherichia col...
WP_010896377   8 ETLSLEEKEKLQTYHLKSTVKLVYENVPFYRKAFQEVDVKPEDIQSLNDVQKLPFTQKHHLRENYPFHLLAVPLNEVVRL 87  Bacillus halodu...
WP_010889515   7 EALPLPQLRALQLAQLQVMVARQYERVPAYRAKFDALGVRPDDLQTLDDLARFPLTRKSDLRENYPLGLLATDRDQLRRI 86  Deinococcus rad...
AAF26285      95 HASSGTTGKPTVVGYTLKDIDTWATVVARSIRASGGRAGDMVHIAYGYGLFTGGLGAHYGAEKLGCTVVPMSGGQTEKQI 174 Azoarcus evansii
BAC48162     120 HASSGTTGKPIVVGYTQRDIDTWSEVMARSIRAAGGRTGMIIHNAYGYGLFTGGLGVHYGAEKLGCTVVPISGGMTERQV 199 Bradyrhizobium ...
P76085        91 HASSGTTGKPTVVGYTQNDIDNWANIVARSLRAAGGSPKDKIHVAYGYGLFTGGLGAHYGAERLGATVIPMSGGQTEKQA 170 Escherichia col...
WP_010896377  88 HGSSGTSGKPTVVAYTQKDLEHWSSIIARSIYMAGGRKGDLLHNAYGYGLFTGGLGLHGGSEKLGCVTVPISGGNTQRQI 167 Bacillus halodu...
WP_010889515  87 HASSGTTGKPTVVAYDANDLNVFSDVVARSLYAAGGRPGMTFHNAYGYGLFTGGLGTHGGAERLGMCTVPISGGGTEKQV 166 Deinococcus rad...
AAF26285     175 QLIQDFKPDIIMVTPSYMLTVLDEMERMG-IDPHQTSLKVGIFGAEPWTQAMRAAMEARAGIDAVDIYGLSEVMGPGVAN 253 Azoarcus evansii
BAC48162     200 QLINDFRPDIITVTPSYMLAILDEFKRQK-LDPRQCSLKVGIFGAEPWTNAMRGEIEDAFDMDATDIYGLSEVIGPGVAQ 278 Bradyrhizobium ...
P76085       171 QLIRDFQPDMIMVTPSYCLNLIEELERQLgGDASGCSLRVGVFGAEPWTQAMRKEIERRLGITALDIYGLSEVMGPGVAM 250 Escherichia col...
WP_010896377 168 TLIQDFKPRVICGTPSYIMNIGETMKKMG-IDPASTSIQYAILGSEPWSEEMRKNLETMFNMKAMDIYGLSEVIGPGVGM 246 Bacillus halodu...
WP_010889515 167 QLIQDLEPQIIACTPSYALVLAEALGRCG-MRPEDISLQYAVLGAEPWSNKTRTEVEARLGVKATNIYGLSEIIGPGVSN 245 Deinococcus rad...
AAF26285     254 ECIEAKDGPVIWEDHFYPEIIDPHTGEVLPDGSEGELVFTTLTKEAMPVIRYRTRDLTRLLP---PTARS-MRRMAKITG 329 Azoarcus evansii
BAC48162     279 ECIETKDGLHIWEDHFYPEVIDPETGAVLPDGEKGELVFTSLTKEGFPVIRYRTRDLTRLLP---GTARPgMRRMEKVTG 355 Bradyrhizobium ...
P76085       251 ECLETTDGPTIWEDHFYPEIVNPHDGTPLADGEHGELLFTTLTKEALPVIRYRTRDLTRLLP---GTART-MRRMDRISG 326 Escherichia col...
WP_010896377 247 ECVECQNGLHIADDHFYPEIIDPITLECLPDGEEGELVFTTLQKEALPVIRYRTGDIASLTRepcECGRT-TARMSRVKG 325 Bacillus halodu...
WP_010889515 246 EDVSEQRGSYLWEDHFYPEILDPDTGEVLPDGEWGVLVLSSMTRTALPVLRYWTGDITRLLPaqnGTGRT-MRRMDQIRG 324 Deinococcus rad...
AAF26285     330 RSDDMLIIRGVNLFPTQVEELICKNPKLAPQYLLEVDKDGHMDTLTVKVEINPEANVGRH-----PEQKealAKELQHDI 404 Azoarcus evansii
BAC48162     356 RSDDMIILRGVNLFPTQIEEVLLATDWCGGHFILELTREGRMDELTIIAEARPESWDGRG-----LVDH---ADRISTHI 427 Bradyrhizobium ...
P76085       327 RSDDMLIIRGVNVFPSQLEEEIVKFEHLSPHYQLEVNRRGHLDSLSVKVELK-ESSLTLT-----HEQRcqvCHQLRHRI 400 Escherichia col...
WP_010896377 326 RVDDMLIIRGVNVFPSEIEQCILKMDELDCHYQLHLVKNGALDEVALHVELKDEYYTLDLhgdlnHPHAsllKGKIQQTL 405 Bacillus halodu...
WP_010889515 325 RSDDLIILRGVNVYPTQLEAVLLGMGQASPHYHVILTRTGIMDDLTLQIEALSESAALR--------------QEIERQI 390 Deinococcus rad...
AAF26285     405 KTFIGVSAKVHVCEPFAIERvTI-GKAKRVVDRR 437 Azoarcus evansii
BAC48162     428 KNTIGISSNVRVVAPATLER-SL-GKARRLYDKR 459 Bradyrhizobium diazoefficiens USDA 110
P76085       401 KSMVGISTDVMIVNCGSIPR-SE-GKACRVFDLR 432 Escherichia coli K-12
WP_010896377 406 KQEMLVSMDVHLKEPGTLPR-FE-GKAKRIVDKR 437 Bacillus halodurans
WP_010889515 391 KAQVGVTVRCELHVPGSLPR-SEgGKLRRVTDLR 423 Deinococcus radiodurans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap