Conserved Protein Domain Family
PhoB

?
TIGR02154: PhoB 
phosphate regulon transcriptional regulatory protein PhoB
PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion. PhoB acts as a positive regulator of gene expression for phosphate-related genes such as phoA, phoS, phoE and ugpAB as well as itself. It is often found proximal to genes for the high-affinity phosphate ABC transporter (pstSCAB; GenProp0190) and presumably regulates these as well. [Regulatory functions, DNA interactions, Signal transduction, Two-component systems]
Statistics
?
PSSM-Id: 131209
View PSSM: TIGR02154
Aligned: 10 rows
Threshold Bit Score: 383.603
Threshold Setting Gi: 27349347
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAD86042       1 MSATVLVVEDESAIQELIAYNLRNAGYTAVCTNSAEQAAAMVNEVlPDLVLLDWMLPGKSGIELARSLRRDPRTKPIPVI 80  Nitrosomonas eu...
P45189         1 MTRKILIVEDECAIREMIALFLSQKYYDVIEASDFKTAINKIKEN-PKLILLDWMLPGRSGIQFIQYIKKQESYAAIPII 79  Haemophilus inf...
CAA56927       1 MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPwPDLILLDWMLPGGSGIQFIKHLKRESMTRDIPVV 80  Shigella flexneri
CAE34832       1 MSSTILVVEDEPAIQELIAVNLSFAGHKVLRAFDAEQAQTLIRAElPDLILLDWMLPGASGLSLARKLRDEERTRAVPVI 80  Bordetella bron...
AAF15533       1 MTPYVLVVEDEDALATLLHYNLDKEGYRVGVAGDGEEALIMANERgPDLVILDWMLPKVSGIEVCRRLRGRAETRNVPII 80  Caulobacter cre...
AAD29647       2 AALRLLLVEDDDALAELLKWHFSKQNFEVVHTRDGDEALLLARENpPDIMLLDWMVEGTSGIEVCRQLRRYPETANLPII 81  Zymomonas mobil...
BAC46361       1 MGARIMVVEDEEALTELLRYNLEGDGYDVETVMRGDDADTRLKEHiPDLIVLDWMLPGLSGIELCRRLRTRPETKQLPII 80  Bradyrhizobium ...
BAC00821       5 DQPVVLLVEDEPAQREVLSYNLESEGFRVVQAGNGDEALMLVEEAgPDVIVLDWMLPSVSGIEVCRQLKSRPSTRSVPII 84  Rhodobacter sph...
WP_010955812  15 VGRNILIVDDEAPIREMIAVALEMAGYDCLEAENSQQAHAIIVDRkPDLILLDWMLPGTSGIELARRLKRDELTGDIPII 94  Pseudomonas putida
WP_003483753   1 MQKRILIVDDEPAIRDMVAFALRKGEFEPIHAGDAREAQTAIADRvPDLILLDWMLPGTSGLDLARRWRKEQLTREIPII 80  Xanthomonas
CAD86042      81 MLTARVDERDKVIGLETGADDYVTKPFSPRELIARIKAVLRRSLPEASDeILDIGGVQINPMTHRVTVTDLNdgthekeL 160 Nitrosomonas eu...
P45189        80 MLTAKSTEEDCIACLNAGADDYITKPFSPQILLARIEAVWRRIYEQQSQ-FIQIDELSIDENAQRVFFQQQE-------I 151 Haemophilus inf...
CAA56927      81 MLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRRISPMAVEeVIKMQGLSLDPTSHRVMAGEEP-------L 153 Shigella flexneri
CAE34832      81 MLTAKGAEQDKVDGLEAGADDYITKPFSPKELMARIKAVLRRRAPQLTDdIIDVAGLKLDPVTHRLSGHSQS-------L 153 Bordetella bron...
AAF15533      81 MLTARGEETDRIRGLDTGADDYVVKPFSMVELTARVRAVLRRIRPGLADdRITVGDIIIDRVAHRVKRSGKE-------I 153 Caulobacter cre...
AAD29647      82 MLTARGEEDDRIRGLETGADDYVTKPFSPRELVARVLAVLRRIRPALSKeQLNYNDIEMDLVSHRVKRAGTN-------V 154 Zymomonas mobil...
BAC46361      81 MLTARGEESERVRGLATGADDYIVKPFSVPELLARVKGLLRRASPERLAtVLAYGDIELDRDKRRVARSGRP-------I 153 Bradyrhizobium ...
BAC00821      85 MLSARSEEVDRVRGLETGADDYVVKPYSVVELMARVRSQLRRARPSSVGlTLEFEDIRLDPETHKVHRGGQL-------L 157 Rhodobacter sph...
WP_010955812  95 MLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLRRTGPSDSEaPIEVGGLLLDPISHRVTIDGKP-------A 167 Pseudomonas putida
WP_003483753  81 MLTARGEENDRVGGLEAGVDDYVVKPFSARELLARIRAVMRRTREDDEDgSVAVGKLRIDGAAHRVFAGDAP-------V 153 Xanthomonas
CAD86042     161 LLSPTEYRLLYFLMAHAERVHTRAQLLDRVWGDHVFVEDRTVDVHIRRLRKALDVAGKADLVQTVRGAGYRFS 233 Nitrosomonas europaea ...
P45189       152 NLSSTEFKLLHFFMRHPEKVYSREQLLNRIWHNDLEVEYRTVDSYIRRLRRNLAPFQCEHYIQTVRGSGYRFS 224 Haemophilus influenzae...
CAA56927     154 EMGPTEFKLLHFFMTHPELVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEPGGHDRMVQTVRGTGYRFS 226 Shigella flexneri
CAE34832     154 SIGPTEFRLLHFFMTHPERVFSRSQLLDQVWGDHVFVEERTVDVHIRRLRKALEPSGHDAHVETVRGSGYRFT 226 Bordetella bronchisept...
AAF15533     154 HLGPTEFRLLDYLMQHPGRVFSREQLLDAVWGSDVYVEARTVDVHIGRLRKELNGTTDADPIRTVRSAGYSLD 226 Caulobacter crescentus...
AAD29647     155 SIGPTEFRLLRHLMEYPRRVFSREKLLDYIWGQDSDIELRTVDVHIRRLRKALNRDGLPDLIRTVRSAGYALD 227 Zymomonas mobilis subs...
BAC46361     154 DLGPTEYRLLEFFLEHPGRVFSREQLLDSVWGRDIYIDERTVDVHIGRLRKLLNLGREQDPIRTVRGAGYALD 226 Bradyrhizobium diazoef...
BAC00821     158 KLGPTEFRLLSTFMEKPGRVWSREQLLDRVWGRDIYVDSRTVDVHVGRLRKALCLHGGEDPVRTVRGAGYALG 230 Rhodobacter sphaeroide...
WP_010955812 168 EMGPTEYRLLQFFMTHQERAYTRGQLLDQVWGGNVYVEERTVDVHIRRLRKALG-EAYENLVQTVRGTGYRFS 239 Pseudomonas putida
WP_003483753 154 PIGPTEYRLLHFFMTHPERVYTRTQLLDHVWGGSVYVEERTIDVHIRRLRKTLEPFGLENMVQTVRGSGYRFS 226 Xanthomonas
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap