
Conserved Protein Domain Family

TIGR02146: LysS_fung_arch 
Click on image for an interactive view with Cn3D
homocitrate synthase
This model includes the yeast LYS21 gene which carries out the first step of the alpha-aminoadipate (AAA) lysine biosynthesis pathway. A related pathway is found in Thermus thermophilus. This enzyme is closely related to 2-isopropylmalate synthase (LeuA) and citramalate synthase (CimA), both of which are present in the euryarchaeota. Some archaea have a separate homocitrate synthase (AksA) which also synthesizes longer homocitrate analogs.
PSSM-Id: 162728
Aligned: 6 rows
Threshold Bit Score: 399.551
Threshold Setting Gi: 18160515
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Q971S5   319 D-KYTGKHALKDRFEKLGVKLSDVELDQVLAKIKS 352 Sulfolobus tokodaii str. 7
O59390   310 D-RFAGKDTIRYYLQKLGIND-EEFVKVLLKRVKS 342 Pyrococcus horikoshii OT3
P48570   337 AnRLTGWNAIKARVDQLNLNLTDDQIKEVTAKIKK 371 Saccharomyces cerevisiae S288c
O87198   320 AsRLTGRHAIKARAEELGLHYGEEELHRVTQHIKA 354 Thermus thermophilus HB27
AAL63863 315 K-LGISVPQDVVEKVVEEVKRINLPRLRDEDLLEI 348 Pyrobaculum aerophilum str. IM2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap