3A9I


Conserved Protein Domain Family
LysS_fung_arch

?
TIGR02146: LysS_fung_arch 
Click on image for an interactive view with Cn3D
homocitrate synthase
This model includes the yeast LYS21 gene which carries out the first step of the alpha-aminoadipate (AAA) lysine biosynthesis pathway. A related pathway is found in Thermus thermophilus. This enzyme is closely related to 2-isopropylmalate synthase (LeuA) and citramalate synthase (CimA), both of which are present in the euryarchaeota. Some archaea have a separate homocitrate synthase (AksA) which also synthesizes longer homocitrate analogs.
Statistics
?
PSSM-Id: 162728
View PSSM: TIGR02146
Aligned: 6 rows
Threshold Bit Score: 399.551
Threshold Setting Gi: 18160515
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3A9I_A     6 IIDSTLREGEQFEKANFSTQDKVEIAKALDEFGIEYIEVTTPVASPQSRKDAEVLASLG----LKAKVVTHIQCRLDAAK 81  Thermus thermophilu...
Q971S5     5 ILDSTLREGEQTPGVVFTIDQRVEIAKALSDVGVQMIEAGHPAVSSDIYEGIKRIMKLKreglITSEIVGHSRAVKKDIE 84  Sulfolobus tokodaii...
O59390     2 ILDSTLREGEQTPGVNYSPEQRLRIALALDEIGVDFIEVGHPAVSKDVFIGIKLIASQD----LNANLLAHSRALLEDID 77  Pyrococcus horikosh...
P48570    25 LIDSTLREGEQFANAFFDTEKKIEIARALDDFGVDYIELTSPVASEQSRKDCEAICKLG----LKAKILTHIRCHMDDAK 100 Saccharomyces cerev...
O87198     6 IIDSTLREGEQFEKANFSTQDKVEIAKALDEFGIEYIEVTTPVASPQSRKDAEVLASLG----LKAKVVTHIQCRLDAAK 81  Thermus thermophilu...
AAL63863   1 MVFSEEWRIRIAKALSDIGVAMIEAGDPNVAPDIKSAIKKIIALKKNGDIKSEIVVHSRavrqDLENAASLEPDRIAVFY 80  Pyrobaculum aerophi...
3A9I_A    82 VAVETGVQGIDLLFGTSKYLRAPHGR-DIPRIIEEAKEVIAYIREAAphVEVRFSAEDTFRSEEQDLLAVYEAVA-PYVD 159 Thermus thermophilu...
Q971S5    85 VAAELEVDRIAIFYGVSDIHLKAKHHvTREEALNIIAETISYAKSHG--VKVRFTAEDGSRTDLDYLIKVCKTARdAGAD 162 Sulfolobus tokodaii...
O59390    78 YVIQADVEWVGIFFCLSNACLRKRFRmSLSQALERISKAIEYAKDHG--LKVRFTPEDTTRTEWENLRRAIELAKeLKVD 155 Pyrococcus horikosh...
P48570   101 VAVETGVDGVDVVIGTSKFLRQYSHGkDMNYIAKSAVEVIEFVKSKG--IEIRFSSEDSFRSDLVDLLNIYKTVDkIGVN 178 Saccharomyces cerev...
O87198    82 VAVETGVQGIDLLFGTSKYLRAAHGR-DIPRIIEEAKEVIAYIREAAphVEVRFSAEDTFRSEEQDLLAVYEAVA-PYVD 159 Thermus thermophilu...
AAL63863  81 GVSDLHLKYKHKKTREEALQIIAEMVsLAKSHGVSVRFTAEDGSRAD--LDYLIQVVKTAYEAGADRVSIADTVGvFTPE 158 Pyrobaculum aerophi...
3A9I_A   160 RVGLADTVGVATPRQVYALVREVRRVVgPRVDIEFHGHNDTGCAIANAYEAIEAGATHVDTTILGIGERNGITPLGGFLA 239 Thermus thermophilu...
Q971S5   163 RVSIADTVGILYPTKTRELFSTLVREV-PGLEFDIHAHNDLGLAVANALAAIEGGATIIHTTVNGLGERVGIVPLQVIAA 241 Sulfolobus tokodaii...
O59390   156 RISVADTTGGTHPLRFYTLVKKVVN---FGIPVNVHCHNDLGLALANAIMGIEGGATVVDATVNGLGERAGIVDLAQIVT 232 Pyrococcus horikosh...
P48570   179 RVGIADTVGCANPRQVYELIRTLKSVV--SCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITPLGGLMA 256 Saccharomyces cerev...
O87198   160 RVGLADTVGVATPRQVYALVREVRRVVgPRVDIEFHGHNDTGCAIANAYEAIEAGATHVDTTILGIGERNGITPLGGFLA 239 Thermus thermophilu...
AAL63863 159 RAREVFSKVKAAVPGVGLDIHAHNDFG-MAVANSLAAVEGGADVVHTTVNGLGERAGITPLQVFAAAYYYHYGVKLIKLE 237 Pyrobaculum aerophi...
3A9I_A   240 RMYTLQPEYVrrkYKLEMLPELDRMVARMVGVEIPFNNYITGETAFSHKAGMHLKAIYINPEAYEPYPPEVFGVKRKLII 319 Thermus thermophilu...
Q971S5   242 AIKYHFGIEV---VKLNKLQQLASLVEKYSGIPMPPNYPITGDYAFIHKAGIHVAGVLNDPSTYEFMPPETFGRSRDYVI 318 Sulfolobus tokodaii...
O59390   233 VLYYHYGVKK---YRLDKLYEISRMVSEITGIALQPNYPIVGENAFTHKAGLHVSAVLKDPRFYEFLPAEVFGRERTIYV 309 Pyrococcus horikosh...
P48570   257 RMIVAAPDYVkskYKLHKIRDIENLVADAVEVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF 336 Saccharomyces cerev...
O87198   240 RMYTLQPEYVrrkYKLEMLPELDRMVARMVGVEIPFNNYITGETAFSHKAGMHLKAIYINPEAYEPYPPEVFGVKRKLII 319 Thermus thermophilu...
AAL63863 238 KLPEITAMVE---AATGITIMPTFPIVGENAFTHKAGVHQAGVLSNPETYEPIPPETVGRNRDFSLDKYSGRKAIQHRLE 314 Pyrobaculum aerophi...
3A9I_A   320 AsRLTGRHAIKARAEELGLHYGEEELHRVTQHIKA 354 Thermus thermophilus HB27
Q971S5   319 D-KYTGKHALKDRFEKLGVKLSDVELDQVLAKIKS 352 Sulfolobus tokodaii str. 7
O59390   310 D-RFAGKDTIRYYLQKLGIND-EEFVKVLLKRVKS 342 Pyrococcus horikoshii OT3
P48570   337 AnRLTGWNAIKARVDQLNLNLTDDQIKEVTAKIKK 371 Saccharomyces cerevisiae S288c
O87198   320 AsRLTGRHAIKARAEELGLHYGEEELHRVTQHIKA 354 Thermus thermophilus HB27
AAL63863 315 K-LGISVPQDVVEKVVEEVKRINLPRLRDEDLLEI 348 Pyrobaculum aerophilum str. IM2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap