
Conserved Protein Domain Family

TIGR02143: trmA_only 
Click on image for an interactive view with Cn3D
tRNA (uracil(54)-C(5))-methyltransferase
This family consists exclusively of proteins believed to act as tRNA (uracil-5-)-methyltransferase. All members of far are proteobacterial. The seed alignment was taken directly from pfam05958 in Pfam 12.0, but higher cutoffs are used to select only functionally equivalent proteins. Homologous proteins excluded by the higher cutoff scores of this model include other uracil methyltransferases, such as RumA, active on rRNA. [Protein synthesis, tRNA and rRNA base modification]
PSSM-Id: 131198
Aligned: 10 rows
Threshold Bit Score: 578.599
Threshold Setting Gi: 20178174
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
P22038 316 YPRILYISCNPETLCKNLETLSQTHTVSRLALFDQFPYTHHMECGVLLTAR 366 Salmonella enterica subsp. enterica serovar Typhim...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap