3BT7


Conserved Protein Domain Family
trmA_only

?
TIGR02143: trmA_only 
Click on image for an interactive view with Cn3D
tRNA (uracil(54)-C(5))-methyltransferase
This family consists exclusively of proteins believed to act as tRNA (uracil-5-)-methyltransferase. All members of far are proteobacterial. The seed alignment was taken directly from pfam05958 in Pfam 12.0, but higher cutoffs are used to select only functionally equivalent proteins. Homologous proteins excluded by the higher cutoff scores of this model include other uracil methyltransferases, such as RumA, active on rRNA. [Protein synthesis, tRNA and rRNA base modification]
Statistics
?
PSSM-Id: 131198
View PSSM: TIGR02143
Aligned: 10 rows
Threshold Bit Score: 578.599
Threshold Setting Gi: 20178174
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3BT7_A  13 QYEAQLAEKVVRLQSMMAPFSDLVPEVFRSPVSHYRMRAEFRIWHD--GDDLYHIIFDQQTK----SRIRVDSFPAASEL 86  Escherichia coli
Q8CX51  10 TYDAQLEAKRIKLEQAFAQFETPSIEVFASDPEHYRMRAEFRVWHE--GDDLYYYMFDKALN----DKVRCDQYLPASTL 83  Shewanella oneidensis...
Q9PP92   7 GNFLTLDEKHSFIKKYFKEFYTKDFKLFASKDKHYRTRAELSFYHE--NDTLFYAMFDPKSK----KKYIIEYLDFADEK 80  Campylobacter jejuni ...
P31812   7 QYNELLQKKLEKLTALLHPFNAPDIQVFDSPTSHYRMRAEFRIWHE--QDDFYHIMFDQATL----QRYRVDEFPIASML 80  Haemophilus influenza...
Q9JT82   3 DYTQQLQDKKDHLKTLFAGLDVPEWEVYESPDKHYRMRAEFRIWHE--GGEMFYAMFEKGQKaggaSLIRCDRFEAASEA 80  Neisseria meningitidi...
Q9HV78  10 AYAAQLEDKKSRLAGLLAPFAAPAPEVFESPREHYRLRAEFRLWREtgNEKRHYAMFEQGDKh---TPILLEDFPIASRR 86  Pseudomonas aeruginos...
Q9RHS9  11 SYTAQLQDKVTRLRDLLAPFDAPEPQVFDSPLQNFRLRAEFRLWRE--GGERHYAMFSQDDKr---TPILIEEFPIASLR 85  Pseudomonas fluorescens
P22038  10 QYEAQLAEKVARLQSMMAPFSGLVPEVFRSPVSHYRMRAEFRLWHD--GDDLYHIMFDQQTK----SRIRVDTFPAASQL 83  Salmonella enterica s...
Q8ZAA0  10 SYDHQLAEKSARLKAMMLPFQAPEPEIFRSPADHYRMRAEFRVWHD--EDDLYHIMFDQQTK----QRIRVEQFPVASRL 83  Yersinia pestis
Q8DD43  10 RYQQQLAEKVQRLTDMFAPYQAPELEVFESPDQHYRMRAEFRVWHE--GEEMYYIMFNQETR----EKYRVDQFPAASRL 83  Vibrio vulnificus CMCP6
3BT7_A  87 INQLMTAMIAGVRNNPVLRHKLFQIDYLTTLSNQAVVSLLYHKKLDDEWRQEAEALRDalraqN-----LNVHLIGRATK 161 Escherichia coli
Q8CX51  84 INEMMAALIAELKPNPSLRHKLFQVDFLSTLSGEILVSLLYHRQLDDQWRAEAIALKA-----Kls-sqFKVNIIGRARK 157 Shewanella oneidensis...
Q9PP92  81 ICAFMPRLLEYLRQDNKLKEKLFGVEFLTT-KQELSITLLYHKNIEDI-KSNLENLSNi----------LHINLIARSKG 148 Campylobacter jejuni ...
P31812  81 INRMMQTLLPLLKQQEVLHKKLFQIDYLSTLSNKIIVSLLYHKTLTEEWESAAKNLKD-----LlekqdFDVQIIGRASK 155 Haemophilus influenza...
Q9JT82  81 VNRLMPELIAVAAQSAELRNRWYAVEFLSTLSGEMLVTMIYHKRLDDEWMQAAQALQQq----------LDTSVIGRSRG 150 Neisseria meningitidi...
Q9HV78  87 INELMPRLKAAW-ADPALGFKLFQVEFLTTLAGDALITLCYHRPIDDAWRQAAEKLAAe----------LGVNLVGRSRG 155 Pseudomonas aeruginos...
Q9RHS9  86 INQLMPQLKAAWQASAALSHKLFQVEFLTTLAGDAMITLCYHRPLDEHWHTAANKLAAd----------LNVSIIGRSKG 155 Pseudomonas fluorescens
P22038  84 INTLMKAMIAGVRDNHALRHKLFQIDYLTTLSNQAVVSLLYHKKLDEEWREAATALRD-----AlraqgLNVHLIGRATK 158 Salmonella enterica s...
Q8ZAA0  84 INRLMDALMTAIRAEPLLRRKLFQIDYLSTLSGKLIASLLYHRQLDEEWQQKALELRD-----QlraqgFDLQLIGRAAK 158 Yersinia pestis
Q8DD43  84 INDLMPLLIDAMKDNESLRRKLFQVDFLSTLSGEILVSLLYHRQLDDAWIENAKALKQ-----RlndegFNLNLIGRARK 158 Vibrio vulnificus CMCP6
3BT7_A 162 TKIELDQDYIDERLPVAGKEMIYRQVENSFTQPNAAMNIQMLEWALDVTKGSKG-DLLELYCGNGNFSLALARNFDRVLA 240 Escherichia coli
Q8CX51 158 QKIDLDKDFVVESLQVNDKVFHYKQIENSFTQPNAKVAIKMLEWAIDVTQNSQG-DLLELYCGNGNFSIALAQNFNRVLA 236 Shewanella oneidensis...
Q9PP92 149 KKLIFKTENLRQTLNIQDRKIFYEFNNDCFIQPNTAINEKMITWVCEILNTQKRmDLLELYCGYGNFTLALAPFFFKILA 228 Campylobacter jejuni ...
P31812 156 QKICFEQDYVDEVLPVNGRNYVYRQVENSFTQPNATVNCKMLEWAIDCTQNSEG-DLLELYCGNGNFSIALAQNFRKVLA 234 Haemophilus influenza...
Q9JT82 151 QKIVLKQDYVTETLKVGNRDFRYRQIEGGFTQPNAAVCQKMLEWACGAAEGLGG-DLLELYCGNGNFTLPLSEKFERVLA 229 Neisseria meningitidi...
Q9HV78 156 KRIVVGRDYVEEELSVAGRRFRYRQPEGAFTQPNGEVNQKMLGWAYEALGQRDD-DLLELYCGNGNFTLPLATRVRKVLA 234 Pseudomonas aeruginos...
Q9RHS9 156 KRDVIGRDYVVEKLDVGGRTFSYRQPEGAFTQPNGTVNQKMLNWAFEALGDRSD-DLLELYCGNGNFTLPLATRVRKVLA 234 Pseudomonas fluorescens
P22038 159 TKIELDQDYIDERLPVAGKEMIYRQVENSFTQPNAAMNIQMLEWALEVTKDSKG-DLLELYCGNGNFSLALARNFNRVLA 237 Salmonella enterica s...
Q8ZAA0 159 TKIMLDHDYIDEVLPVAGREMIYRQVENSFTQPNAAVNIHMLEWALDVTQGATG-DLLELYCGNGNFSLALARNFERVLA 237 Yersinia pestis
Q8DD43 159 MKIVLDRDYVVEKLDVNGKPYTYQQVENSFTQPNGKVAEKMLEWAVDCTQESQG-DLLELYCGNGNFSLALAQNFERVLA 237 Vibrio vulnificus CMCP6
3BT7_A 241 TEIAKPSVAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREFNRLQ--GIDLKSYQCETIFVDPPRSGLDSETEKMVQA 318 Escherichia coli
Q8CX51 237 TELAKPSVDAAQYNIEINGIDNLQIIRMSAEEFSDAMAKKRSFRRLE--GIDLDSYLCNTIFVDPPRAGIDPATLDLVQG 314 Shewanella oneidensis...
Q9PP92 229 TEISKSNINFALKNCELNNTTNIHFARLSSEELSLAIKKEREFFRLK--DIRLDDFNFSHVLVDPPRAGLDKSVIDLIKK 306 Campylobacter jejuni ...
P31812 235 TEIAKPSVAAAQFNIAENKVDNLQIIRMSAEEFTQAMNGVRAFNRLK--GIDLKSYECNTIFVDPPRAGLDPDTVKLVQN 312 Haemophilus influenza...
Q9JT82 230 TEISKTSVGAAQWNIEANGIGNIKIARLSAEEFTEAYTGKREFARLKdgGIALTDYAFSTIFVDPPRAGIDEETLKLVSQ 309 Neisseria meningitidi...
Q9HV78 235 TEISKSSVNAALANLADNAVDNVSLVRLSAEELTQALNEVRPFRRLA--DIDLKSYAFGSVFVDPPRAGMDPDTCELARR 312 Pseudomonas aeruginos...
Q9RHS9 235 TEISKTSVNAALSNLDENAVDNVTLVRLSAEELTEALNEVRPFRRLH--GIDLKSYEFGSVFVDPPRAGMDPDTCELTRR 312 Pseudomonas fluorescens
P22038 238 TEIAKPSVAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREFNRLQ--GIDLKRYQCETIFVDPPRSGLDSETEKMVQA 315 Salmonella enterica s...
Q8ZAA0 238 TEIAKPSVAAAQYNIAANNIDNVQIIRMSAEEFTQAMQGVREFNRLK--GIDLGSYNCETIFVDPPRSGLDHETVKLVQA 315 Yersinia pestis
Q8DD43 238 TELAKPSVESAQYNIAANKIENVQIIRMSAEEFTEAMEGKREFRRLKdnGIDLKSYNCNTIFVDPPRSGMDVDTCKMVQG 317 Vibrio vulnificus CMCP6
3BT7_A 319 YPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMQCGVLLTAK 369 Escherichia coli
Q8CX51 315 YERILYISCNPDTLKDNLQQLYKTHKVTRFALFDQFPYTDHMETGVLLERI 365 Shewanella oneidensis MR-1
Q9PP92 307 YGNIIYISCNPMTLKENLKELSLTHRVEEFALFDQFVNTPHLECGVFLSKV 357 Campylobacter jejuni subsp. jejuni NCTC 11168 = AT...
P31812 313 YDRILYISCNPHTLCDNLVELSKTHRIEKAALFDQFPYTDHMESGLWLIRK 363 Haemophilus influenzae Rd KW20
Q9JT82 310 FDNIIYISCNPETLRANLDTLVETHVVERAALFDQFPFTHHIESGVLLKKK 360 Neisseria meningitidis Z2491
Q9HV78 313 FERILYISCNPETLAQNIAQLHDTHRISRCALFDQFPYTHHMESGVLLERR 363 Pseudomonas aeruginosa PAO1
Q9RHS9 313 FENILYISCNPETLAANIAQLHDTHRITQCAMFDQFPWTHHMESGVLLTRR 363 Pseudomonas fluorescens
P22038 316 YPRILYISCNPETLCKNLETLSQTHTVSRLALFDQFPYTHHMECGVLLTAR 366 Salmonella enterica subsp. enterica serovar Typhim...
Q8ZAA0 316 YPRILYISCNPETLCANLEQLQHTHKISRLALFDQFPYTHHMECGVLLEKR 366 Yersinia pestis
Q8DD43 318 YERILYISCNPETLKENLDILSETHHITRFALFDQFPYTHHMEAGVMLERK 368 Vibrio vulnificus CMCP6
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap