Conserved Protein Domain Family
modC_ABC

?
TIGR02142: modC_ABC 
molybdenum ABC transporter, ATP-binding protein
This model represents the ATP-binding cassette (ABC) protein of the three subunit molybdate ABC transporter. The three proteins of this complex are homologous to proteins of the sulfate ABC transporter. Molybdenum may be used in nitrogenases of nitrogen-fixing bacteria and in molybdopterin cofactors. In some cases, molybdate may be transported by a sulfate transporter rather than by a specific molybdate transporter. [Transport and binding proteins, Anions]
Statistics
?
PSSM-Id: 131197
View PSSM: TIGR02142
Aligned: 6 rows
Threshold Bit Score: 522.75
Threshold Setting Gi: 585499
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P37732         6 IRARFRVDYAGFALDVDLTLPGHGVTALFGHSGSGKTTLLRCVAGLERAAEARLEINGELWQDSAAgvFLPTHRRALGYV 85  Azotobacter vin...
Q08381         2 ISARFSGRQGDFTLDAAFDVPGQGVTALFGPSGCGKTTVLRCMAGLTRLPGGHLVVNGVTWQEGRQ--ITPPHRRAVGYV 79  Rhodobacter cap...
P09833         2 LELNFSQTLGNHCLTINETLPANGITAIFGVSGAGKTSLINAISGLTRPQKGRIVLNGRVLNDAEKgiCLTPEKRRVGYV 81  Escherichia col...
WP_000005533   4 VILQLQKRLGETQLDVDLRLPAVGICAIFGRSGAGKTSLINLISGLTTPDVGEIHLAGRTLFSSSQgiQLPIEQRKIGYV 83  Vibrio cholerae
WP_010972403   3 LSVSARHRLGTFELDASFTSEG-GVTALFGRSGSGKTSMIRIIAGLLRPDEGQISLDGEVLADSGKrlFLPAHKRRFGYV 81  Agrobacterium f...
WP_010932139   3 LCIDIEKRLGDFSLKLKTEISG-ERVGIFGASGSGKSTLVHLIAGLIKPYAGEIYLDDTCLFSSRKkiDLSPEKRRISIV 81  Chlorobaculum t...
P37732        86 FQEASLFPHLSVRRNLEYGMKRVDAASRqVSWERVLELLGIGHLLERLPGRLSGGERQRVGIARALLTSPRLLLMDEPLA 165 Azotobacter vin...
Q08381        80 FQEASLFTHLSVRENLVYGLRRARGPLR-ISEAEVTQLLGIDPLLRRPTATLSGGERQRVAIGRALLSQPELLLMDEPLS 158 Rhodobacter cap...
P09833        82 FQDARLFPHYKVRGNLRYGMSKSMVDQ----FDKLVALLGIEPLLDRLPGSLSGGEKQRVAIGRALLTAPELLLLDEPLA 157 Escherichia col...
WP_000005533  84 FQDARLFPHYTVRGNLNYGVTDADPEY----FASVTRLLALEPLLVRYPRDLSGGEKQRVAIGRALLSKPDLLLMDEPLA 159 Vibrio cholerae
WP_010972403  82 FQEARLFPHLSVAQNLRYGRWFTTGKDTnANDDRIIDMLGISHLLQRRPNRLSGGEKQRVAIGRALLSSPRLLLMDEPLA 161 Agrobacterium f...
WP_010932139  82 FQQATLFPHLGVKSNLLYGYKRCRPSERrIRPEAIIEVLNLGHLVGRGVGKLSGGEKQRVALGRAVLANPRLLVMDEPLS 161 Chlorobaculum t...
P37732       166 ALDLKRKNEILPYLERLHDELDIPMLFVSHLPDEVARLADHVVLLDQGRVTAQGSLQDIMARLDL-P-TAFHEDAGVVIE 243 Azotobacter vin...
Q08381       159 ALDRISRDEILPYLERLHASLQMPVILVSHDLSEVERLADTLVLMEAGRVRAAGPIAAMQADPNL-P-LIHRPDLAAVIE 236 Rhodobacter cap...
P09833       158 SLDIPRKRELLPYLQRLTREINIPMLYVSHSLDEILHLADRVMVLENGQVKAFGALEEVWGSSVM-NpWLPKEQQSSILK 236 Escherichia col...
WP_000005533 160 SLDMPRKKEVMPFLENLAQHFRLPILYVSHSMQEILRLADHLVVLEQGKVLSAGPIEQVWSSKAMrP-WQSFSEQSTLFS 238 Vibrio cholerae
WP_010972403 162 SLDEQRKAEIIPYLERLRDETKIPIVYVSHSIQEVARLADRVVVMKDGKVEAEGKAAEVLSRPDF-StYLERREAGSILS 240 Agrobacterium f...
WP_010932139 162 ALDDSLRYQIIPYLRSVSAEFGIPCLFISHSLTEMQLMTERVLVVRDGRLAGISTPDELARTG------MATNPRGYLNL 235 Chlorobaculum t...
P37732       244 SVVAEHDDHYHLTRLAFP-GGAVLVARRPEAPGQRLRLRVHARDVSLANSRIEDSSITNVLPATVREVVEAD---TpAHV 319 Azotobacter vin...
Q08381       237 GVVIALDPAYGLSTLQVP-GGRIVVPGNLGPIGARRRLRVPATDVSLGRHAPTDTTILNALPAVILGAEAAEgyqItVRL 315 Rhodobacter cap...
P09833       237 VTVLEHHPHYAMTALALG-DQHLWVNKLDEPLQAALRIRIQASDVSLVLQPPQQTSIRNVLRAKVVNSYDDN-----GQV 310 Escherichia col...
WP_000005533 239 ATVAKHHQTYGLTQVRLAeDVWLWVQQVEADVGSSVRMQVRANDVSIALDKPTASSIRNILPARIVAIEHQQp-sK-KSV 316 Vibrio cholerae
WP_010972403 241 GNIESFDERHGLAAVRLN-AALLQVPAKKATAGTPARVLIPARDVMLALVKPEGLSALNILEGHVTGISESE---D-GMV 315 Agrobacterium f...
WP_010932139 236 LRLDGATQKDGLFHYPWG-NGHLIISE--GRTGEESLFELSSRDIILFKQHPEAISARNLLECRVAELFDSD-----GRK 307 Chlorobaculum t...
P37732       320 LVRLEAE-GTPLIARITRRSCDQLGIAPGRRMWAQIKAVALL 360 Azotobacter vinelandii
Q08381       316 ALGASGE-GASLLARVSRKSFDLLGFQPGEQVVARLKAMALS 356 Rhodobacter capsulatus
P09833       311 EVELEVG-GKTLWARISPWARDELAIKPGLWLYAQIKSVSIT 351 Escherichia coli K-12
WP_000005533 317 SLKLELApHCYLWAVVTEWAHAELALEVGMPVFAQIKGVSVA 358 Vibrio cholerae
WP_010972403 316 TIQMDCG-GDIIQSRITDLSRERLHLEPGKPVHAIIKSAALD 356 Agrobacterium fabrum
WP_010932139 308 GVVLESG-GKTLVAEIVRSAAEELGIAPGTMLFAAIKASAFR 348 Chlorobaculum tepidum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap