Conserved Protein Domain Family
permease_CysW

?
TIGR02140: permease_CysW 
sulfate ABC transporter, permease protein CysW
This model represents CysW, one of two homologous, tandem permeases in the sulfate ABC transporter system; the other is CysT (TIGR02139). The sulfate transporter has been described in E. coli as transporting sulfate, thiosulfate, selenate, and selenite. Sulfate transporters may also transport molybdate ion if a specific molybdate transporter is not present. [Transport and binding proteins, Anions]
Statistics
?
PSSM-Id: 162725
View PSSM: TIGR02140
Aligned: 7 rows
Threshold Bit Score: 344.372
Threshold Setting Gi: 446874108
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P74547        12 VKYLLIALALFYLILVLLLPAIAVFYEAFHKGVEPFIQAMGDRNFQSALQLTVVMALISVPLNTVFGLCAAWVLARNQFP 91  Synechocystis s...
WP_006174414  16 VRNILIWLAAGLSVLCIGAPLAVIFSYAFSKGIHVFFSEILKPDTLHAVWLTVLTAIVVVPINMAFGVCVAWLVTKFRFP 95  Brucella
WP_000808268   8 VRSFLIGVVFFLTVLILILPIYTVFQEAFSKGFGAYWEGIREPDTISAFKLTLLVIGIAVPLNTIFGIFAAFSLTRFEFP 87  Leptospira inte...
WP_010899273  22 VKVTLIGIALSFLFLFLVLPLIAIFYRAFEQGLAVYFASISEPDALSAIKLTFLVVLITVPLNTLFGIAAAWAIGKFQFR 101 Bacillus halodu...
WP_014001256   7 ARYLVRSVALGYVFVLLIVPVALILWRTFEPGFGQFYAWISTPAAISALNLSLLVVAIVVPLNVIFGVTTALVLARNRFR 86  Mycobacterium c...
WP_010893850  37 VQWLLILGALGFLLAFLLLPLMLVFSEALRGGVQVFLRAVSDPDALAAIRLTMLVTMIVLPVNMVFGVAVAWAVSKHQFP 116 Xylella fastidiosa
WP_000951364  15 VKWSLISLALLLVAVLLLIPLLSIFQQAFANGISAYFSYFNDPDTRHAIGLTLVVALLTVPINLVFGVLLSWLVTRFEFV 94  Vibrio mimicus
P74547        92 GRALFLSVLDLPFSISPVVAGLMIVLLYGKNGW--------------IGSWFASWDIQIIFSVPGMAIATIFVTLPFVAR 157 Synechocystis s...
WP_006174414  96 GRRLLITFVEIPFSVSPIVAGVTYLFLYGSQGL--------------LGPFLEAHDIKIMFTVPAIFLVSLFVTSPFVAR 161 Brucella
WP_000808268  88 GKSWILTIIDSPFSVSPVISGLIFILLFGRQGW--------------FGPWLEKLDFKIVFNTPGLVIATVFITLPFVAR 153 Leptospira inte...
WP_010899273 102 GKNLLTTFIDLPFSVSPVIAGLIFVLLFSSHGV--------------FGPWLLDRGIQIIFSIPGIVLATMFVTVPFVAR 167 Bacillus halodu...
WP_014001256  87 GKGVLQAIIDLPFAVSPVIVGVSLILLWGSAGA--------------LGFVEQDLGFKIIFGLPGIVLASMFVTCPFVVR 152 Mycobacterium c...
WP_010893850 117 GKRLLVSLIDLPFSVSPVVAGLVFVLIFGRQGWawpliedgvrfslpLFGEVMVKLPRVVFALPGIVLATIFVTFPFIAR 196 Xylella fastidiosa
WP_000951364  95 GRKFLITLIDIPFAVSPVVAGLLYLLLYGTSGW--------------LGEWLYERDLQIMFAWPGIVLVTVFVTCPFVAR 160 Vibrio mimicus
P74547       158 EVIPVLEELGPEQEEAARTLGAKDWQIFWRVTLPNIRWGLLYGVLLTNARAMGEFGAVAVVSGSILGKTSTLPIFVEQEY 237 Synechocystis s...
WP_006174414 162 ELIPLMEVQGSDEEEAALTLGASAWQTFFYVTLPNIKWALLYGAVLCNARVMGEFGATSVVSGAIRGKTNTLPLQVELLF 241 Brucella
WP_000808268 154 ELIPVLDATGMEEEEAGLLLGASPIKVFLKIVAPGIKYGLLYGIILCNARAMGEFGAVSVLSGHIRGQTNTLPLQIEVLY 233 Leptospira inte...
WP_010899273 168 ELIPVMQAQGTAQEEASLTLGASGWKTLWHVTLPNVKWALLYGVILCNARAIGEFGAVSVVSGHIRGLTNTMPLHIEILY 247 Bacillus halodu...
WP_014001256 153 EVEPVLHELGTDQEQAAATLGSGWWQTFWRITLPSIRWGLTYGIVLTVARTLGEYGAVIIVSSNLPGTSQTLTLLVSDRY 232 Mycobacterium c...
WP_010893850 197 ELMPLMEQQGNEEELAALSLGASGWQTFWRVTLPNIRWGLLYGALLCGARAMGEFGAVSVVSGHIRGRTNTMPLHVEILY 276 Xylella fastidiosa
WP_000951364 161 ELIPLMQQQGRSDEEAAVILGASWWQLFRRVTLPNIKWALIYGVILTNARAVGEFGAVAVVSGNIRGETNTLPLHVQLLY 240 Vibrio mimicus
P74547       238 KNYQTEAAFGAAVVLALLAVVTLVLKEILEQRTGH 272 Synechocystis sp. PCC 6803 substr. Kazusa
WP_006174414 242 NDYNVAGAFAAASTLALIALVTLVLKVFLERKQHS 276 Brucella
WP_000808268 234 NEYNSVAAFSAASLLVFLSLITLVAKQILERKIKI 268 Leptospira interrogans
WP_010899273 248 NEYQFTAAFAVASLMSLLAIFTLIVKNIIEWKSTT 282 Bacillus halodurans
WP_014001256 233 HRGAEYGAYALSTLLMAVSVVVLIVQMVLDARRAR 267 Mycobacterium canettii
WP_010893850 277 SEYAYSAAFACASLLALSALLTLALKAFLEKRHGE 311 Xylella fastidiosa
WP_000951364 241 EDYQSQAAFASASLLAFIALLTLLLKALVEWRQER 275 Vibrio mimicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap