Conserved Protein Domain Family
permease_CysT

?
TIGR02139: permease_CysT 
sulfate ABC transporter, permease protein CysT
This model represents CysT, one of two homologous, tandem permeases in the sulfate ABC transporter system; the other is CysW (TIGR02140). The sulfate transporter has been described in E. coli as transporting sulfate, thiosulfate, selenate, and selenite. Sulfate transporters may also transport molybdate ion if a specific molybdate transporter is not present. [Transport and binding proteins, Anions]
Statistics
?
PSSM-Id: 131194
View PSSM: TIGR02139
Aligned: 12 rows
Threshold Bit Score: 331.597
Threshold Setting Gi: 446453955
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9MUL9         3 YFSKLSCSWRITLGYLLFMLILPILALLSRASQELFSNFWSIAMEPAAIYAYSITLSMALIASIVNGIFGIFIAWILVRY 82  Mesostigma viride
P26246        22 FLTKFELVLACALHYGTFILALPIFFLLYKTKQQPWNILLQTALEPVVLSAYGFTFLTALLATIINAIFGLILAWVLVRY 101 liverwort
WP_010899272  12 ILPGFGLSLGFTMMYLGILVLLPLSMVFINTSSMGWQAFWQAITEPRVLASYRLSFGAAIIAASINAVFGLLIAWVLVRY 91  Bacillus halodu...
WP_006166489  19 VIPGFGLTFGFSVAYLTLIILIPLAALVLRSSDVGLAGFWRIVTDERTLKALETSFGTAFIAALVNVVFGVILAWVLVRY 98  Brucella
WP_000817968  15 GKTAFGITLGVTVTYLSLIVIIPLGALFLKSTGIGWEGFWKLLTHERILAALYLSFGAGATAAILNLFIGFLFAWVLVRY 94  Leptospira inte...
WP_005763424   8 VIPGFGLTLGYTLVYLSLIVLLPLAAMFIHAAQLTWDQFWTIITAPRVIAALKLSFGTAFYAALINGVIGTLLAWVLVRY 87  Pseudomonas syr...
WP_011036155  17 VMPGLGLSLGITLTWLGLIVLIPLLGVFIKTSGLGWDGLWRVWSEPRVLSALRVSFGTAFAAGAFNAVMGTWVAWVFVRY 96  Xanthomonas cam...
EGC58519      37 VLPGFKLSLGLTVLCLSLLVVLPFAMMAAKAAEIGWGGFWNTIAEPNVLAAVWLSLRMSFYAMLTNVVFGTLVAWVLVRY 116 Neisseria menin...
WP_010994497  22 KVVNLPWTWRITIGYLTVMLFVPIIAMFLKASTEPPARFWEIATSELALATYNVTFVTSLLAALLNGVFGTLIAWVLVRY 101 Nostoc sp. PCC ...
WP_011074247   9 VLPGFGITLGFSVLYLSLLFLLPVAGLILFTLQMSWADFWVAISHPQVVASYKLSFAASFIGATINAVFGTLVAWVLVRY 88  Shewanella onei...
KEY53474       5 VLPGLKLSLGVTLTYVAIIVLLPLSALVFKAASLGPAEYWSIISSPRAVASYRVTVLCALAATLFNVVFGVALAWVLTRY 84  Agrobacterium t...
WP_000531810  15 VLPGFALSLGVSLLFVSLILLLPATGLIMQTSNMTFSEYWQVIADPRVVASYKVTVGSALIASLFNGLFGLLLAWVLVRY 94  Vibrio cholerae
Q9MUL9        83 NFPGKRIVDAAIDLPFALPTSVAGLTLATVYSEKGWIGHFLQSLSIKVVFTKLGVGVAMIFVSFPFVVRTLQPVLQDIEK 162 Mesostigma viride
P26246       102 EFPGKKLLDATVDLPFALPTSVGGLTLMTVFNDKGWIKPICSWLNIKIVFNPIGVLLAMIFVSLPFVVRTIQPVLQNMEE 181 liverwort
WP_010899272  92 HFPGKRIIDGLVDLPFALPTAVAGIALTTLYTTNGWIGQYLEVFGIRIAFTPLGVIVALTFIGLPFVVRMVQPVLQGIEK 171 Bacillus halodu...
WP_006166489  99 RFAGRRFVDAIVDIPFALPTAVAGISLAAIYAPNGWIGGLLSPYGIRIAFTRMGIVIALIFIGLPFVVRTVQPIIEEISR 178 Brucella
WP_000817968  95 NFPGKSLLDSLVDLPFTLPTAVAGIALTTIYTPNGIIGKFFEPFGIKIAYTPIGIVIALVFIGFPFVVRTVQPVLEEFPK 174 Leptospira inte...
WP_005763424  88 TFPGRKIIDAMIDLPFALPTAVAGIALTALYAPNGWVGQFAADLGFKIAYTPLGITLALTFVTLPFVVRTVQPVLADIPR 167 Pseudomonas syr...
WP_011036155  97 RFPGKRLFDALIDLPFALPTAVAGIALTALYGGNGWVGRWLEAIGIKVAYTQLGIVIALVFVGLPFVVRVVQPVLAESER 176 Xanthomonas cam...
EGC58519     117 EFPGKGLANALVDLPFALPTAVTGIALATLYAPNGWIGRFFEPLGIKIAFTPVGIWIALVVVSLPFIVRAVQPVLEELSG 196 Neisseria menin...
WP_010994497 102 DFPLKRIIDATVDLPFALPTSVAGLTLATVYSDNGWIGSLLAPLGIKVSFTRLGVWVAMVFISLPFVVRTVQPVLQEMEH 181 Nostoc sp. PCC ...
WP_011074247  89 QFLGKKVVDALVDLPFALPTAVAGIALVTLYSTTGWVGQYLYLWGIKVAYSEIGVVIALTYIGLPFVVRTVQPVLADFSK 168 Shewanella onei...
KEY53474      85 RFPGWRIVDAIVDLPFALPTAVAGIALTTLFAGNGWFGSLLAPLGIKVAYTPVGIMVAMAFTSLPFIVRTVQPVLEDLDP 164 Agrobacterium t...
WP_000531810  95 TFPGKRILDALVDLPFALPTAVAGITLATLYSANGWIGSVLAELGIKVAYTPLGIIVAMAFTSIPFVVRTVQPVLEEISR 174 Vibrio cholerae
Q9MUL9       163 ELEEAAWSLGASSWTTFWKVIFPSLIPSLLTGIALAFSRAVGEYGSVVIIASNIPFKDLTAPVLIFQKLEQYDYTGATVI 242 Mesostigma viride
P26246       182 DLEEAAWCLGASPWTTFWHILFPPLTPSLLTGTTLGFSRALGEYGSIVLIASNIPMKDLVISVLLFQKLEQYDYKSATII 261 liverwort
WP_010899272 172 ELEEASACLGANRLQTFSKIIFPTVLPALLTGFALAFARALGEYGSVVFISGNLPMQTEITPLLIMTKLEQFDYAGATAL 251 Bacillus halodu...
WP_006166489 179 EVEEAAATLGASRFQTIWRVLLPGLQPAIITGFALAFARGIGEYGSVIFIAGNTPYKSEIAPLLIVIKLEEYDYAGATAL 258 Brucella
WP_000817968 175 ELEESAYCLGANRWQIFRRVIFPELVSPLVTGAAMAFARGIGEYGSVVFISGNLPGKTEILPLLIVTKLEQYEYEEATGI 254 Leptospira inte...
WP_005763424 168 EVEEAAACLGARPLQVFRHILVPALLPAWLTGFALAFARGVGEYGSVIFIAGNMPMKTEILPLLIMVKLDQYDYTGATAI 247 Pseudomonas syr...
WP_011036155 177 EIEEAAATLGASRWQLVWRVVLPALWPAVLTGFALAFARGVGEYGSVIFIAGNLPNATEIAPLLITIRLEEFDYAGATAI 256 Xanthomonas cam...
EGC58519     197 EYEEAAATLGASRWTTFRRVLLPEITPALLTGAGMMFARATGEYGSVIFIAGNIPMVSEILPLIITGKLEQFDVQGASAV 276 Neisseria menin...
WP_010994497 182 DVEEAAWSLGASQWQTFSKVILPPLLPSILTGVALGFSRAVGEYGSTVIIASNTPFQDLIAPVLIFQRLEQYDYSGATVI 261 Nostoc sp. PCC ...
WP_011074247 169 ELEEASASLGASRFTTIKRVILPAVLPALLTGYALAFARAVGEYGSVIFISGNLPYRTEITPLLIVSKAEQYDYNGAAAI 248 Shewanella onei...
KEY53474     165 ALEEAAQSLGGSDLEVFRKIILPLLTPALLAGLSLSFARSLGEFGAIIFIAGNQPFSTEITALLIFIRLEEYDYQAAAAI 244 Agrobacterium t...
WP_000531810 175 EEEEAGMTLGASDAAVFWKVILPSLKPALLVGTALSFTRSLGEFGAVIFIAGNMPYISEITSLMIFVRLQEFDFPAASAI 254 Vibrio cholerae
Q9MUL9       243 GTVILSISLFILVGINIIQSLNQMY 267 Mesostigma viride
P26246       262 ASFVLIISFTALFFINKIQLWKKTF 286 liverwort
WP_010899272 252 AAVMLIISFFMLLFINILQWWSQRR 276 Bacillus halodurans
WP_006166489 259 ATVMLALSFAMLLFINLIQTRIRRK 283 Brucella
WP_000817968 255 AFIMLVISFSILLCINVIQNIAARK 279 Leptospira interrogans
WP_005763424 248 GVMMLVVSFILLLLINLLQRRIETP 272 Pseudomonas syringae group
WP_011036155 257 AAAMLLLSFVILLVVNTLQARLLRY 281 Xanthomonas campestris
EGC58519     277 ALFMLLVSFVILFALNVMQWALGRR 301 Neisseria meningitidis M0579
WP_010994497 262 GVVLLTISLVLLLGINLLQGWARRY 286 Nostoc sp. PCC 7120
WP_011074247 249 GVVMLAAAFILLLIINSLQWWASKR 273 Shewanella oneidensis
KEY53474     245 ASVLLITAFVMLAVTNYLQARALRY 269 Agrobacterium tumefaciens
WP_000531810 255 ASVVLLTSLLLLLMINLWQGAYLRS 279 Vibrio cholerae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap