1RKU


Conserved Protein Domain Family
HSK-PSP

?
TIGR02137: HSK-PSP 
Click on image for an interactive view with Cn3D
phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein
This protein is has been characterized as both a phosphoserine phosphatase and a phosphoserine:homoserine phosphotransferase. In Pseudomonas aeruginosa, where the characterization was done, a second phosphoserine phosphatase (SerB) and a second homoserine kinase (thrB) are found, but in Fibrobacter succinogenes neither are present. This enzyme is a member of the haloacid dehalogenase (HAD) superfamily, specifically part of subfamily IB by virtue of the presence of an alpha helical domain in between motifs I and II of the HAD domain. The closest homologs to this family are monofunctional phosphoserine phosphatases (TIGR00338).
Statistics
?
PSSM-Id: 162723
View PSSM: TIGR02137
Aligned: 3 rows
Threshold Bit Score: 384.279
Threshold Setting Gi: 504359878
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1RKU_A         2 MEIACLDLEGVLVPEIWIAFAEKTGIDALKATTRDIPDYDVLMKQRLRILDEHGLKLGDIQEVIATLKPLEGAVEFVDWL 81  Pseudomonas aer...
WP_014546980   5 QCVVTLDLEGVLAPEIWIAVAEKTGIKDLRLTTRDIPDYDVLMKGRIKILERENIKLSDIQNVIANLGLLDGARDFMDTL 84  Fibrobacter suc...
CAA07580       1 MEIACLDLEGVLVPEIWIAFAEKTGIDALKATTRDIPDYDVLMKQRLRILDEHGLKLGDIQEVIATLKPLEGAVEFVDWL 80  Pseudomonas aer...
1RKU_A        82 RERFQVVILSDTFYEFSQPLMRQLGFPTLLCHKLEIDDsDRVVGYQLRQKDPKRQSVIAFKSLYYRVIAAGDSYNDTTML 161 Pseudomonas aer...
WP_014546980  85 RDEAQVIILSDTFQEFAYPIMKNLGFPTIFCHNLVVEN-DMIKGYHLRMSDQKTKVVKHLQELNFKVFASGDSFNDTGML 163 Fibrobacter suc...
CAA07580      81 RERFQVVILSDTFYEFSQPLMRQLGFPTLLCHKLEIDDsDRVVGYQLRQKDPKRQSVIAFKSLYYRVIAAGHSYNDTTML 160 Pseudomonas aer...
1RKU_A       162 SEAHAGILFHAPENVIREFPQFPAVHTYEDLKREFLKASSrSL 204 Pseudomonas aeruginosa PAO1
WP_014546980 164 KQADKGCFFCAPDSIVAQFPQLEATKTYAELLDKFHKFQD-SL 205 Fibrobacter succinogenes
CAA07580     161 SEAHAGILFHAPENVIREFPQFPAVHTYEDLKREFLKASSrSL 203 Pseudomonas aeruginosa PAO1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap