Conserved Protein Domain Family
transald_staph

?
TIGR02134: transald_staph 
transaldolase
This small family of proteins is a member of the transaldolase sybfamily represented by pfam00923. Coxiella and Staphylococcus lack members of the known transaldolase equivalog families and appear to require a transaldolase activity for completion of the pentose phosphate pathway. [Energy metabolism, Pentose phosphate pathway]
Statistics
?
PSSM-Id: 131189
View PSSM: TIGR02134
Aligned: 3 rows
Threshold Bit Score: 412.366
Threshold Setting Gi: 447019238
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
lhbprmlnih:CBU_0675   6 LQELKVKIFADGANLEEMVKFSTHPYIKGFTTNPTLMRQAGIVDYEAFAHQALAQITKLPISFEVFADELDEMEDQARYI 85  Coxiella...
WP_011018236          3 TKKLNVKVFSDGAVLETMLKDLQTGLVTGFTTNPSLMKKAGISSYIGFAKEVLAQITDYPVSFEVFADDLASMEKEAEKI 82  Streptoc...
WP_001096494          1 MAKLNVEVFADGADIEEMKAAYKNKQVDGFTTNPSLMAKAGVTDYKAFAEEAVKEIPDASISFEVFADDLETMEKEAAIL 80  Staphylo...
lhbprmlnih:CBU_0675  86 ASWGNNVNIKIPVTNTKGQFTGPIIQRLSEDGITLNITALTTHSQVEKVCQSFADDTPGIVSVFAGRVADSGRDPEDHMR 165 Coxiella...
WP_011018236         83 ASLGNNVYVKIPVTTSTGESTCPLIQKLSAKGIKLNVTAIFTIEQTQAVVDHLTAGVPAIVSVFAGRIADTGVDPMPIME 162 Streptoc...
WP_001096494         81 KQYGENVFVKIPIVNTKGESTIPLIKKLSADNVRLNVTAVYTIEQVKEITEAVTEGVPTYVSVFAGRIADTGVDPLPLMK 160 Staphylo...
lhbprmlnih:CBU_0675 166 KALEIVAQKPSLELLWASPRELFNIIQANRIGCHIITVAHNILAKLP-LLGKDLTQYSLETVQMFARDAQASRYSIH 241 Coxiella bu...
WP_011018236        163 EALRICRQKEGVELLWASPRETYNIYQADQLGVDIITCTTDLIAKLP-LQGKDLEDYSLETVQMFLKDSTSLGFKIL 238 Streptococc...
WP_001096494        161 EAVKVTHSKDGVKLLWASCRELFNVIQADEIGADIITCPADVVKKVNtNLGRDINELSVDTVKGFAKDIQSSGLSIL 237 Staphylococ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap