Conserved Protein Domain Family
phaR_Bmeg

?
TIGR02132: phaR_Bmeg 
polyhydroxyalkanoic acid synthase, PhaR subunit
This model describes a protein, PhaR, localized to polyhydroxyalkanoic acid (PHA) inclusion granules in Bacillus cereus and related species. PhaR is required for PHA biosynthesis along with PhaC and may be a regulatory subunit.
Statistics
?
PSSM-Id: 131187
View PSSM: TIGR02132
Aligned: 2 rows
Threshold Bit Score: 238.574
Threshold Setting Gi: 27348112
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAD05258   1 MEQQKvFDPFQAWKDVYDKTESYWGKVIGDNMNREEFSQLMGNVLNMNLQYQQAVNEVTGRYLHQVNVPTKEDVANVASL 80  Bacillus megaterium
BAC45230   1 MIDQK-FDPLQAWKNAYEQTETFWGKALNETIKTEEYSAWMGSVLDLNLFYQKALNDTTKNYLEQVNVPTKEDIARVATL 79  Bacillus sp. INT005
AAD05258  81 VINVEEKVELLEEQFDDRFDELEaqqeSASALKKDVTKLKSDVKSLDKKLDKVLSLLEgqqktqdelketiqkqiktqge 160 Bacillus megaterium
BAC45230  80 VINLENKVDNIEEFLEDKVESVG----QAPTLKRDVTKVKQDIRTLETKVDQILELLE---------------------- 133 Bacillus sp. INT005
AAD05258 161 qlqaqlleKQEKLAEKPKAEAKSEAKPSN 189 Bacillus megaterium
BAC45230 134 --------KQNAVLAKLQEPVKEEVKPTN 154 Bacillus sp. INT005
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap