Conserved Protein Domain Family
phaP_Bmeg

?
TIGR02131: phaP_Bmeg 
polyhydroxyalkanoic acid inclusion protein PhaP
This model describes a protein found in polyhydroxyalkanoic acid (PHA) gene regions and incorporated into PHA inclusions in Bacillus cereus and Bacillus megaterium. The role of the protein may include amino acid storage (see McCool,G.J. and Cannon,M.C, 1999).
Statistics
?
PSSM-Id: 131186
View PSSM: TIGR02131
Aligned: 2 rows
Threshold Bit Score: 187.252
Threshold Setting Gi: 29895008
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAD05256   1 MSTVKYDtVIDAMWEQWTKGLQNIADGNKQIEQWTLKALEQQQEFVTKAVEQLQATDKQWKAELEDLQQKTVENLRKTAG 80  Bacillus megaterium
AAP08296   1 METKPYE-LVDAFWKNWSQSLSLFSSAGKQLEQLTLETLKQQQDALHKLTSGVDELEKELQQLTAQFNNQYTDYVKQLTG 79  Bacillus cereus ATC...
AAD05256  81 NAVADSYEEWTNRTHEALNKLQELFFNQSKSSYSLVKQAQEQYHQVVTQLVEEQKKTRQEFQHVSDAYVEQVKSLQKSFA 160 Bacillus megaterium
AAP08296  80 NSLNDQINEWQDKWKELSAHMHQLTVSPTKTSLSILTQTSGQFEETTKQFIEQQQLQREEAQKQLEGFLEEFKSKQLELA 159 Bacillus cereus ATC...
AAD05256 161 QSLEQ 165 Bacillus megaterium
AAP08296 160 KKFEE 164 Bacillus cereus ATCC 14579
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap