Conserved Protein Domain Family
dapB_plant

?
TIGR02130: dapB_plant 
dihydrodipicolinate reductase
This narrow family includes genes from Arabidopsis and Fibrobacter succinogenes (which probably recieved the gene from a plant via lateral gene transfer). The sequences are distantly related to the dihydrodipicolinate reductases from archaea. In Fibrobacter this gene is the only candidate DHPR in the genome. [Amino acid biosynthesis, Aspartate family]
Statistics
?
PSSM-Id: 131185
View PSSM: TIGR02130
Aligned: 2 rows
Threshold Bit Score: 525.702
Threshold Setting Gi: 21593099
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAM65048      75 ISIMVNGCSGKMGKAVIKAADSAGVNIVPTSFGSVEEAGQTVEVCGKEILVHGPTEREKVLSSVFEKYPELIVVDYTIPS 154 thale cress
WP_014545090   3 VQVMVNGIPGNMGRIVAETCVARGLELVPYSLTGEIIVENEAEVAGKTIQLLKPSNREARIGEVLAKYPNMICIDYTHPT 82  Fibrobacter suc...
AAM65048     155 AVNDNAELYGKVGVPFVMGTTGGDRTRLYKTVEESKIYAVISPQMGKQVVAFLAAMEIMSEQFPGAFAGYSLEVMESHQA 234 thale cress
WP_014545090  83 AVNDNAAFYVKHKIPFVMGTTGGDREALAKLVADANHPSVIAPNMAKQIVAFQMMIEFLAKEFPTAFEGYKLSVVESHQK 162 Fibrobacter suc...
AAM65048     235 SKLDASGTAKAVISCFQKLGVSYDMDQIQLIRDPKQQIEVVGVPEEHVSGHAFHLYHLTSPDKTVSFEFQHNVCGRSIYA 314 thale cress
WP_014545090 163 TKADTSGTARAVVGTFQKMGFDYTPDDIEKVRNEKEQMERMHVPEEYLGGHAFHTYSLDSADGTVHFEFQHNVCGRKIYA 242 Fibrobacter suc...
AAM65048     315 EGTVDAVLFLAKKiRSKAEKRIYNMIDVLREGNMR 349 thale cress
WP_014545090 243 EGTVDAVNFLADQ-IAAGTAKPFNMMDVLRSGKMR 276 Fibrobacter succinogenes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap