Conserved Protein Domain Family

TIGR02130: dapB_plant 
dihydrodipicolinate reductase
This narrow family includes genes from Arabidopsis and Fibrobacter succinogenes (which probably recieved the gene from a plant via lateral gene transfer). The sequences are distantly related to the dihydrodipicolinate reductases from archaea. In Fibrobacter this gene is the only candidate DHPR in the genome. [Amino acid biosynthesis, Aspartate family]
PSSM-Id: 131185
Aligned: 2 rows
Threshold Bit Score: 525.702
Threshold Setting Gi: 21593099
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
WP_014545090 243 EGTVDAVNFLADQ-IAAGTAKPFNMMDVLRSGKMR 276 Fibrobacter succinogenes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap