Conserved Protein Domain Family
panF

?
TIGR02119: panF 
sodium/pantothenate symporter
Pantothenate (vitamin B5) is a precursor of coenzyme A and is made from aspartate and 2-oxoisovalerate in most bacteria with completed genome sequences. However, some pathogens must import pantothenate. This model describes PanF, a sodium/pantothenate symporter, from a larger family of Sodium/substrate symporters (pfam00474). Several species that have this transporter appear to lack all enzymes of pantothenate biosynthesis, namely Haemophilus influenzae, Pasteurella multocida, Fusobacterium nucleatum, and Borrelia burgdorferi. [Biosynthesis of cofactors, prosthetic groups, and carriers, Pantothenate and coenzyme A, Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 131174
View PSSM: TIGR02119
Aligned: 5 rows
Threshold Bit Score: 656.416
Threshold Setting Gi: 492609380
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAP10487       3 WYVIIPMIISFIVEFLIGVYASKRVQATAhnkFLQEYFLGGRELGGLLLAMTMIATYGSASSFIGGPGIAYNMGLGWVLL 82  Bacillus cereus...
P44963         3 LGIILPLIIYLTFVFGAAIFAYVKRTKGD---FLTEYYVGNRSMTGFVLAMTTASTYASASSFVGGPGAAYKYGLGWVLL 79  Haemophilus inf...
WP_002210065   3 TDVVLPLVGYLVLVFGLSIYAYTRRQTGN---FLNEYFIGNRSMGGFVLAMTLTATYISASSFIGGPGAAYKYGLGWVLL 79  Yersinia
WP_011064905   3 WEAVIPLFLLIFIIFLVGMWSSKFVRNTDs--FVQEYFLGGRSLGGFILAMTLVTTYGSASSFLSGPGTAYNEGLGWVLL 80  Oceanobacillus ...
WP_005902082   4 iliiipiiiYLVTMLLIAYKVNNIKNSSKs--FTNEYYLGSRSMGGFVLAMTIVATYVGASSFIGGPGIAYNLGLGWVLL 81  Fusobacterium n...
AAP10487      83 SAIQVVTGYIVLTVIGKKFAIIARKMEAITLIDYLKGRYNNKAVVILSALCIIIFLFSATVAQWVGGGRLIESLTGLSYT 162 Bacillus cereus...
P44963        80 AMIQVPVVWLALGALGKKFALLSRETNALTINDLFFYRYKNKYLVWLSSLALLLAFFAAMTVQFIGGARLLETTIGISYT 159 Haemophilus inf...
WP_002210065  80 AMIQLPAVWLSLGVLGKKFAILARRYNAVTLNDMLYARYQSRLLVWLASISLLVAFVGAMTVQFIGGARLLETAAGIPYD 159 Yersinia
WP_011064905  81 SMTQLATGYFVLMVLGKRFAIVTRKYKAVTIVDFLKERYQSKWVVLLSSFSILIFLFSAMSAQWIGGGRLIQSLTGMSYL 160 Oceanobacillus ...
WP_005902082  82 ACIQVPTAFFTLGVLGKKLSIISRKLNAITIFDVLKARYNNSFLNVLASIMLIVFFISAIVAQFIGGARLFEAVTGLSYL 161 Fusobacterium n...
AAP10487     163 TALFLFTFSVLVYVLIGGFRAVALSDTLLGIIMLVGTTIILIATVIAGGGIEKIMQELVQINPKLITPFGADGSLTKSYV 242 Bacillus cereus...
P44963       160 QALLLFALTVGIYTFIGGFRAVVLTDTIQGTVMIFGTIILLIGTIYALGGVESAVNKLTEIDPDLVTPYGPNGMLDFQFM 239 Haemophilus inf...
WP_002210065 160 TGLLIFGISIALYTSFGGFRASVLNDALQGLVMLIGTILLLVAVIHAAGGLHKAVETLQHIDPALVSPQGGDQILDVPFM 239 Yersinia
WP_011064905 161 SALFIFSAAVLIYVIVGGFRAVAITDGIQGIIMFLGTLILLIAVIVAGGGVPQIMEDLRAENMNLITPFGADGGLTPAFV 240 Oceanobacillus ...
WP_005902082 162 TGLIIFSSVVIIYTTFGGFRAVTLTDAIQAVVMFTATTVLFVVILKNGNGMENIMMKIKDIDPNLLRPDSGGN-IAKPFI 240 Fusobacterium n...
AAP10487     243 TSFWILIGIGVVGLPQISVRAMSYKNSKAMHQALIIGTVVVGTIMIGMHLTGVFARVVLPGITVPDKVMPLLAMEVLPPW 322 Bacillus cereus...
P44963       240 ASFWILVCFGVVGLPHTAVRCMAFKDSKALHRGMLIGTIVLSIIMLGMHLAGALGRAVIPNLTVSDQVIPTLMIKVLPPI 319 Haemophilus inf...
WP_002210065 240 ASFWILVCFGVIGLPHTAVRCISYRDSKAVHRGIILGTIVVAILMFGMHLAGALGRAVLPDLKIPDQVIPTLMITVLPPF 319 Yersinia
WP_011064905 241 SSFWILVGVGVIALPQIAVRAMSYKNSRSLHRAIIISTIVVGFIMLNMHLIGVLGRPVMPGIEVGDTVMPLLAQEVLPGW 320 Oceanobacillus ...
WP_005902082 241 MSFWILVGIGILGLPATTIRCMAFKDTKAMHNAMIIGTSLVGILVLGMHLVGVMGRAVIPDLQEVDKIIPILALKNLYPI 320 Fusobacterium n...
AAP10487     323 LAGVFLAAPMAAIMSTVNSLLLLVSSSIIKDIYVNYINKDAA-DSTIKKGSLWITGIVGLLVYAAAIKPPDFLIWLNLFS 401 Bacillus cereus...
P44963       320 VAGIFLAAPMSAIMSTIDAQLIQSSSIFVKDLYLSAKPEAAKnEKKVSYFSSIITLILTALLIFAALNPPDMIIWLNLFA 399 Haemophilus inf...
WP_002210065 320 AAGIFLAAPMAAIMSTINAQLLQSSATIVKDLYLNLWPAELKnERKLARISSLSTLILGLLLLLAAWRPPEMIIWLNLLA 399 Yersinia
WP_011064905 321 LAGIVLAAPMAAIMTTVNSLLLMVSSTIIKDVYLNYIEKEAT-DKKVRGLSMGVTALIGVIVIVMSLQPPDLIIWLNLFS 399 Oceanobacillus ...
WP_005902082 321 LAGVFIGGPLAAAMSTVDSLLIISSSTLIKDLYVTYLDKNTS-ESKIKKISMCTSFLIGILVFILSIKPISLIAWVNLFA 399 Fusobacterium n...
AAP10487     402 FGGLEAAFIWPIVLGLYWRKGNATGALASILVGVGSYMCIHLFYPNPFGIHTVVFPICFAFIAYVIGSMSAVKK 475 Bacillus cereus ATCC ...
P44963       400 FGGLEAAFLWVIVLGIYWDKANAYGALSSMIIGLGSYILLTQLGIKLFNFHQIVPSLVFGLIAFLVGNKLGERR 473 Haemophilus influenza...
WP_002210065 400 FGGLEAVFLWPLVLGLYWERANAHGALSAMIVGAVCYTVLASFDIKIAGLHPIVPSLTLNLLAFYIGNLFGDRA 473 Yersinia
WP_011064905 400 MGGLEAAFIWPIVLGLYWNRGNKYGAIASMITGVSSYIIFESFFPQPFGMHSVVTSITIALIAYIIGSLSKQHP 473 Oceanobacillus iheyensis
WP_005902082 400 LGGQEIVFFCPLILGLYWKGANATGAIASIFAGIATYLTLEILKTKIFALHNIVPGLVVAIIVFIVASYFGKKS 473 Fusobacterium nucleatum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap