2GK4


Conserved Protein Domain Family
coaB_strep

?
TIGR02114: coaB_strep 
Click on image for an interactive view with Cn3D
phosphopantothenate--cysteine ligase, streptococcal
In most bacteria, a single bifunctional protein catalyses phosphopantothenoylcysteine decarboxylase and phosphopantothenate--cysteine ligase activities, sequential steps in coenzyme A biosynthesis (see TIGR00521). These activities reside in separate proteins encoded by tandem genes in some bacterial lineages. This model describes proteins from the genera Streptococcus and Enterococcus homologous to the C-terminal region of TIGR00521, corresponding to phosphopantothenate--cysteine ligase activity. [Biosynthesis of cofactors, prosthetic groups, and carriers, Pantothenate and coenzyme A]
Statistics
?
PSSM-Id: 131169
View PSSM: TIGR02114
Aligned: 5 rows
Threshold Bit Score: 339.867
Threshold Setting Gi: 488310346
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2GK4_A         5 KILVTSGGTSEAIDSVRSITNHSTGHLGKIITETLLSAGYEVCLITTKRALKPEPHPNLSIREITNTKDLLIEXQERVQD 84  Streptococcus p...
WP_010922346   2 KLIITSGGTTEPIDAVRGITNHSTGQLGKLITERFLQYHHDVTLVTTKTATKPLPNKRLRIIEVETVNDLMAALKDQVPH 81  Streptococcus p...
WP_000282568   7 KILITSGGTTEKIDTVRSITNHATGTLGKIIAEKYLREGHQVTLVTTKNAVKPESATNLSTFEIEDVDSLIKTLKPLVKE 86  Streptococcus a...
WP_000699501   2 KILVTSGGTSEAIDSVRSITNHSTGHLGKIITETLLSAGYEVCLITTKRALKPEPHPNLSIREITNTKDLLIEMQERVQD 81  Streptococcus p...
WP_002379731   2 DVLVTAGGTSEPIDNVRSITNHSSGGLGKAIAESFLAAGHTVTYVTTKHALRPTQQLDLSIKEIETTVELATTLEQLFAE 81  Enterococcus fa...
2GK4_A        85 --YQVLIHSXAVSDYTPVYXTGLEEVQAS----------------------SNLKEFLSKQNHQAKISSTDEVQVLFLKK 140 Streptococcus p...
WP_010922346  82 --HDILIHSMAVSDYTPVYMTDLEQVSQA----------------------DNLNCFLCEHNSEPKISSASDYQVLFLKK 137 Streptococcus p...
WP_000282568  87 --HDILIHSMAVSDYTPVYMADFEKVKSS----------------------DHLDTFLRKDNHEGKISSESEYQVLFLKK 142 Streptococcus a...
WP_000699501  82 --YQVLIHSMAVSDYTPVYMTGLEEVQAS----------------------SNLKEFLSKQNHQAKISSTDEVQVLFLKK 137 Streptococcus p...
WP_002379731  82 kqFDAIVHAMAVSDFTTETAQTEEQFIDSfaqqlseqtlpktkealvtivqNTLNQIADIPQTATKISSDTDRLLIFLKK 161 Enterococcus fa...
2GK4_A       141 TPKIISLVKEWNPTIHLIGFKLLVDVTEDHLVDIARKSLIKNQADLIIANDLTQISADQHRAIFVEKN-QLQTVQTKEEI 219 Streptococcus p...
WP_010922346 138 TPKVISYVKQWNPNIKLVGFKLLVNVPQEELIKVARASLAKNHADYILANDLVDIQTGMHKALLISNN-EVASADTKEAI 216 Streptococcus p...
WP_000282568 143 TPKVISLVKKWNPQITLVGFKLLVNVTKENLFKVARHSLIKNKATFILANDLIDITSKHHIAYLLDHD-NVYKATTKEDI 221 Streptococcus a...
WP_000699501 138 TPKIISLVKEWNPTIHLIGFKLLVDVTEDHLVDIARKSLIKNQADLIIANDLTQISADQHRAIFVEKN-QLQTVQTKEEI 216 Streptococcus p...
WP_002379731 162 NPKVIQMIRDKQPQTVLVGFKLLVNVSQEELVQVAQAALVKNRCDFVLANDLMNVHETEHKGLLINETgIVQEAYSKQGI 241 Enterococcus fa...
2GK4_A       220 AELLLEKIQAYH 231 Streptococcus pneumoniae TIGR4
WP_010922346 217 ADLLYERMTKHD 228 Streptococcus pyogenes
WP_000282568 222 AQLIYEKVKKYD 233 Streptococcus agalactiae
WP_000699501 217 AELLLEKIQAYH 228 Streptococcus pneumoniae
WP_002379731 242 GSMIVKNVEKKW 253 Enterococcus faecalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap