Conserved Protein Domain Family
coaC_strep

?
TIGR02113: coaC_strep 
phosphopantothenoylcysteine decarboxylase, streptococcal
In most bacteria, a single bifunctional protein catalyses phosphopantothenoylcysteine decarboxylase and phosphopantothenate--cysteine ligase activities, sequential steps in coenzyme A biosynthesis (see TIGR00521). These activities reside in separate proteins encoded by tandem genes in some bacterial lineages. This model describes proteins from the genera Streptococcus and Enterococcus homologous to the N-terminal region of TIGR00521, corresponding to phosphopantothenoylcysteine decarboxylase activity. [Biosynthesis of cofactors, prosthetic groups, and carriers, Pantothenate and coenzyme A]
Statistics
?
PSSM-Id: 131168
View PSSM: TIGR02113
Aligned: 6 rows
Threshold Bit Score: 311.361
Threshold Setting Gi: 489222076
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q54433         3 KKILLAVSGSIAAYKAADLSHQLTKLGYHVNVLMTNAAKQFIPPLTLQVLSKNPVYSNVMKEDDPQVINHIALAKQADLF 82  Streptococcus m...
WP_000595814   3 KRITLAVTGSISAYKAADLTSQLTKIGYDVHIIMTQAATEFITPLTLQVLSKNPIHLDVMDEHNPKIINHIELAKRTDLF 82  Streptococcus a...
WP_010922347   3 KHITLAVSGSISAYKAADLTSQLTKIGYDVHIIMTQAATQFITPLTLQVLSKNAIHLDVMDEHDPKVINHIELAKRTDLF 82  Streptococcus p...
ESU75100       7 KTILLGVSGSISAYKAADITSQLAKLGYNVEILMTKSSTAFITPLTLQSLSKNPVHTDVMMEIDPSKINHIELAKKADLF 86  Enterococcus fa...
WP_001284128   2 ANILLAVTGSIASYKSADLVSSLKKQGHQVTVLMTQAATEFIQPLTLQVLSQNPVHLDVMKEPYPDQVNHIELGKKADLF 81  Streptococcus
WP_003130511   2 TKITLAVTGSIAAYKAADLTSLLTKEGHDVTVLMTKSATQFITPLTLQVLSKNKVHLDIMDEERPELVNHIDLAKNTELF 81  Lactococcus lactis
Q54433        83 LLAPASANTLAHLAHGFADNIVTSVALALPLEVPKFFAPAMNTKMYENPITQSNIALLKKFGYKEIQPKSSVLACGDVGS 162 Streptococcus m...
WP_000595814  83 IVAPASANTIAHLAYGFADNIVTSVALAMPDETPKLIAPAMNTKMYHNTITQRNIDILKKIGYQEIEPRISLLACGDTGQ 162 Streptococcus a...
WP_010922347  83 IVAPASANTIAHLAYGFADNLVTSVALALPATTPKLIAPAMNTKMYQNPITQENIKRLSTIGFTEIPPKSSLLACGDKGP 162 Streptococcus p...
ESU75100      87 LVAPASANTIGKLAHGIADDLLSTVALALYPETPKIIAPAMNTYMYQNPIVQRNIGILKEVGYQEIIPREALLACGDYGR 166 Enterococcus fa...
WP_001284128  82 IVVPATANTIAKLAHGFADNMVTSTALALPSHIPKLIAPAMNTKMYDHPVTQNNLKTLETYGYQLIAPKESLLACGDHGR 161 Streptococcus
WP_003130511  82 LVAPATADTISRLAQGRADDIVTSVALALEPSVPKYFAPAMNTKMYQHPLTQKNIEILKKIDYNMIQPKKSLLACGDFGE 161 Lactococcus lactis
Q54433       163 GALADLDTIIQKIEEQL 179 Streptococcus mutans UA159
WP_000595814 163 GALADISTILKCIQEVA 179 Streptococcus agalactiae
WP_010922347 163 GALADIDVILATIDTIW 179 Streptococcus pyogenes
ESU75100     167 GALATVEDILQTVMKIL 183 Enterococcus faecalis CBRD01
WP_001284128 162 GALADLTIILERIKETI 178 Streptococcus
WP_003130511 162 GALADLPDILSDLKNSL 178 Lactococcus lactis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap