Conserved Protein Domain Family
cyd_oper_ybgE

?
TIGR02112: cyd_oper_ybgE 
cyd operon protein YbgE
This model describes a small protein of unknown function, about 100 amino acids in length, essentially always found in an operon with CydAB, subunits of the cytochrome d terminal oxidase. It appears to be an integral membrane protein. It is found so far only in the Proteobacteria. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 131167
View PSSM: TIGR02112
Aligned: 6 rows
Threshold Bit Score: 100.122
Threshold Setting Gi: 33149013
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAC59318       8 VAKFHEPMDKTLLRVLSLILGFMHVGLVMWDPEAYHQAIGGFNAVIAPALIWALCSSMVFGVGFKPRNWYWQLLFSPYFS 87  Vibrio parahaem...
P37343         5 IATLYAVMDKRPLRALSFVMALLLAGCMFWDPSRFAAKTSELEIWHGLLLMWAVCAGVIHGVGFRPQKVLWQGIFCPLLA 84  Escherichia coli
AAP96531       2 IHSIYNLTRKGWLKALSFILALLLFIVILLNPQVFASYFGGHVPYLAIFVFYGMAILWIHGIGLDIHRTFWQLLFLPIMG 81  Haemophilus duc...
WP_001286617  12 IARCHDITDKALLKALSILLGFYNAAMVMWDPNSYADRIGGFNAVIAPLMIWAICASMVFGVGFRPRHWVWQIVFSPYLS 91  Vibrio cholerae
WP_002228036  18 SDKLYELMDKGPLRALSLVLAFALAFCVFWDPTRFAAATSSLEVWQEVFIVWAVCTGVIHGVGFRPKQVWLRAFFAPLPA 97  Yersinia
WP_005717137   2 INSLYQIFNKGSLRTLSFIFAILITLFFFFNINDFSTNLRSAPAPLILLMIWGTGILWIHGIGFEIRSTLWKGLFSPIIG 81  Pasteurella mul...
BAC59318      88 LAILIYLTALYFM 100 Vibrio parahaemolyticus RIMD 2210633
P37343        85 DIVLIVGLIFFFF 97  Escherichia coli
AAP96531      82 YLIVISTLIFLIL 94  Haemophilus ducreyi 35000HP
WP_001286617  92 LTILSYLTLVQLI 104 Vibrio cholerae
WP_002228036  98 IVILATGLFYFFA 110 Yersinia
WP_005717137  82 YIGFILAIVVSWA 94  Pasteurella multocida
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap