Conserved Protein Domain Family
PQQ_syn_pqqC

?
TIGR02111: PQQ_syn_pqqC 
coenzyme PQQ biosynthesis protein C
This model describes the coenzyme PQQ (pyrrolo-quinoline-quinone) biosynthesis protein PqqC.In contrast to the broader model pfam05312, this model does not include related proteins likely to be functionally distinct from PqqC, such as homologs found in the Chlamydias. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 131166
View PSSM: TIGR02111
Aligned: 5 rows
Threshold Bit Score: 427.72
Threshold Setting Gi: 32129889
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8P6M9   5 LSPDQLEADLRAIGArLYHDQHPFHALLHHGKLNRGQVQAWALNRFEYQRCIPLKDAAILARMEDPALRRIWRQRILDHD 84  Xanthomonas campestri...
Q88QV6   7 MSPAEFEQALRAKGA-YYHIHHPYHVAMYQGRATREQIQGWVANRFYYQVNIPMKDAAILANCPDREVRREWIQRLLDHD 85  Pseudomonas putida KT...
P07780   8 LTTEQFKQAIIDKGQ-YYHIYHPFHVMMYEGKATQQQIQAWVANRYYYQINIPLKDAAIMANCPDQRVRQEWIQRMIDQD 86  Acinetobacter calcoac...
Q49150  17 LSHEELEAALRDIGArRYHNLHPFHRLLHDGKLSKDQVRAWALNRYYYQAMIPVKDAALLARLPDAQLRRIWRQRIVDHD 96  Methylobacterium exto...
Q9EXV0   5 TDRQAFHARLLEIGKeRYHDKHPFHAMLHGGGCTTTQVRAWVINRYYYQSRIPMKDAAFLSRCDDPDMRRAWRSRIEDHD 84  Sinorhizobium melilot...
Q8P6M9  85 GNSPSDGGIARWLHLTDALGLPRELVESGRALLPGTRFAVQAYLHFVREKSLLEAIASSLTELFAPNIIGQRVAGMLQHY 164 Xanthomonas campestri...
Q88QV6  86 GAPGEDGGIEAWLRLGQAVGLDPDQLRSQELVLPGVRFAVDAYVNFARRASWQEAASSSLTELFAPQIHQSRLDSWPQHY 165 Pseudomonas putida KT...
P07780  87 GEYPDGGGREAWLRLAEAVGLSREQVISEELVLPGVRFAVDAYVNFRRRASWREAASSSLTELFAPQIHQSRLDSWPQHY 166 Acinetobacter calcoac...
Q49150  97 GDHEGDGGIERWLKLAEGVGFTRDYVLSTKGILSATRFSVDAYVHFVSERSLLEAIASSLTEMFSPTIISERVAGMLKNY 176 Methylobacterium exto...
Q9EXV0  85 GGVEEGGGIRRWLRLAEAVGLDPAYVGSARGVLPSTRFAVDAYVSFVREKPLLEAVASSLTELFAPKIHSERIAGLLEHY 164 Sinorhizobium melilot...
Q8P6M9 165 DFVSPEALAYFEHRLTEAPRDSDFALDYVKQHADTIEKQQLVKAALHFKCSVLWAQLDALHVAYVSpgVVWPDAFVPER 243 Xanthomonas campestris...
Q88QV6 166 PWIDPAGYEYFRTRLGQARRDVEHGLAITLQHYTTRAGQERMLEILQFKLDILWSMLDAMSMAYEL--NRPPYHSVTQE 242 Pseudomonas putida KT2440
P07780 167 PWIDDKGYEYFRSRLSQARRDVEHGLTITLDSFTTFEQQERMLEILQFKLDILWSILDALTLAYVH--NEAPYHSVTSK 243 Acinetobacter calcoace...
Q49150 177 DFITKDTLAYFDKRLTQAPRDADFALDYVKRHATTPEMQRAAIDALTFKCNVLWTQLDALYFAYVApgMVPPDAWQPGE 255 Methylobacterium extor...
Q9EXV0 165 AFADDAALAYFRQRLAEVPRDVEFGLAYVLDHADTREKQDAAAQALTFKTDVLWAQLDALYSAYVTpgRIPPGAWDGRE 243 Sinorhizobium meliloti...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap