Conserved Protein Domain Family
PQQ_syn_pqqE

?
TIGR02109: PQQ_syn_pqqE 
coenzyme PQQ biosynthesis enzyme PqqE
This model describes coenzyme PQQ biosynthesis protein E, a prototypical peptide-cyclizing radical SAM enzyme. It links a Tyr to a Glu as the first step in the biosynthesis of pyrrolo-quinoline-quinone (coenzyme PQQ) from the precursor peptide PqqA. PQQ is required for some glucose dehydrogenases and alcohol dehydrogenases. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 162708
View PSSM: TIGR02109
Aligned: 8 rows
Threshold Bit Score: 634.463
Threshold Setting Gi: 32363222
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P27507     6 PTVNPPLWLLAELTYRCPLQCPYCSNPLDFARQDKELTTEQWIEVFRQARAMGSVQLGFSGGEPLTRKDLPELIRAARDL 85  Klebsiella pneumoniae
P71517    12 DVIPAPVGLLAELTHRCPLRCPYCSNPLELDRRSAELDTQTWLRVLTEAAGLGVLHVHLSGGEPTARPDIVEITAKCAEL 91  Methylobacterium ex...
Q89FG1    10 ETFGIPLAVLLEITHRCPLQCPYCSNPVELDRSGKELTTDEWKKVLSELAEIGVLQVHFSGGEPTARKDLVELVKHASDV 89  Bradyrhizobium diaz...
Q9EXU8    16 PRILPPMAMLAELTHRCPLACPYCSNPIALTQAKEELSTEEWTGVFAQAADLGVLHLHLSGGEPAARRDLVELTQAASSL 95  Sinorhizobium melil...
P59749     4 PAVGAPAGMLIELTHRCPLHCPYCSNPLELVRREAELTCEQWTDILTQARELGVVQMHFSGGEPLARPDLPDLVGHARRL 83  Streptomyces rochei
Q9I2C0    10 ESVGPPLWLLAELTYRCPLQCPYCSNPLEFAREGAELSTAEWIEVFRQARELGAAQLGFSGGEPLLRQDLAELIEAGRGL 89  Pseudomonas aerugin...
P07782     3 EGVGLPLWLLAELTYRCPLQCPYCSNPLDYAQHKNELTTQEWFDVFDQARQMGAVQLGFSGGEPLVRQDLEQLVAHAHQQ 82  Acinetobacter calco...
CAB83201   2 TLPSPPMSLLAELTHRCPLSCPYCSNPLELERKAAELDTATWTAVLEQAAELGVLQVHFSGGEPMARPDLVELVSVARRL 81  Gluconobacter oxydans
P27507    86 GFYTNLITSGIGLTESKLDAFSEAGLDHIQISFQASDEVLNAALAGNKKAFQQKLAMAKAVKARDYPMVLNFVLHRHNID 165 Klebsiella pneumoniae
P71517    92 GLYSNLITSGVGGALAKLDALYDVGLDHVQLSVQGVDAANAEKIGGLKNAQPQKMQFAARVTELGLPLTLNSVIHRGNIH 171 Methylobacterium ex...
Q89FG1    90 GLYTNLITSAVLLTRERLSELADAGLCHVQISFQGVEEGLADRVAGYRNAHRKKLEVAKWTRELDLPLTVNAVMHRQNLH 169 Bradyrhizobium diaz...
Q9EXU8    96 GLYTNLITSGVGLTEARMNSLADAGLDHIQLSIQGVSPESADRIGGYKGGYERKMAVAGWAADAAIPLTLNAVCHRQNMG 175 Sinorhizobium melil...
P59749    84 GAYVNLVTSGVGLTAERAHDLARRGVDHVQLSLQDADPAAGQAIAGAR-VHTAKLEAARAVTAAGLPLTVNIVLHRGNID 162 Streptomyces rochei
Q9I2C0    90 GFYTNLITSGIGLDEARLARFAEAGLDHVQISFQAADEEVNNLLAGSRKAFAQKLAMARAVKAHGYPMVLNFVTHRHNID 169 Pseudomonas aerugin...
P07782    83 GFYTNLITSGMGLTEQRIADLKQAGLDHIQVSFQASDPVVNDALAGSKHAFEQKYEMCRLVKKYDYPMVLNFVIHRHNID 162 Acinetobacter calco...
CAB83201  82 NLYSNLITSGVLLDEPKLEALDRAGLDHIQLSFQDVTEGGAERIGGLKGAQARKIAAARLIRASGIPMTLNFVVHRENVA 161 Gluconobacter oxydans
P27507   166 QLDKIIELCIELEADDVELATCQFYGWAFLNREGLLPTREQIARAEQVVADYRQKMAASgnlTNLLFVTPDYYEERPKGC 245 Klebsiella pneumoniae
P71517   172 EVPGFIDLAVKLGAKRLEVAHTQYYGWAYVNRAALMPDKSQVDESIRIVEAARERLKGQ---LVIDLVVPDYYAKYPKAC 248 Methylobacterium ex...
Q89FG1   170 QLPDIIQMSIDLDADRLEVANVQYYGWALKNRAALMPTVAQLDECTRLVEEARERLKGR---LSIDYVVPDYYALRPKKC 246 Bradyrhizobium diaz...
Q9EXU8   176 EIDEMIELAIRLKARRIEVATVQFHGWAERNKEVLMPTREQVECATRTVAEAREKYQGI---LVIDYVPADYYSKYPKAC 252 Sinorhizobium melil...
P59749   163 RTGRMVDLAVDLGADRIELANTQYYGWGLRNRAALMPTAAQLAAAREAVRHARTRYAGG---PELVYVAADYYDDRPKPC 239 Streptomyces rochei
Q9I2C0   170 NIERIIQLCIELEADYVELATCQFYGWAALNRAGLLPTRAQLERAERITAEYRQRLAAEgnpCKLIFVTPDYYEERPKAC 249 Pseudomonas aerugin...
P07782   163 QIEQIIELCLELNADTVELAICQFYGWAFLNRQGLLPTQEQLTRAERITNEYREKLKAQnhpCKLIFVVPDYYEERPKAC 242 Acinetobacter calco...
CAB83201 162 RIPEMFALARELGAGRVEIAHTQYYGWGLKNRDALLPSRDQLEESTRAVEA--ERAKGG---LSIDYVTPDYHADRPKPC 236 Gluconobacter oxydans
P27507   246 MGGWGSIFLSVTPEGTALPCHSARQLP-VAFPSVL-EQSLESIWYDSFGFNRYRGYDWMPEPCRSCDEKEKDFGGCRCQA 323 Klebsiella pneumoniae
P71517   249 AGGWGRKLMNVTPQGKVLPCHAAETIPgLEFWYVT-DHALGEIWTKSPAFAAYRGTSWMKEPCRSCDRREKDWGGCRCQA 327 Methylobacterium ex...
Q89FG1   247 MGGWGRQFFNISPAGKVLPCHAAESITgLDFESVRsNHSIAWIWQNSEAFNRYRGTGWMKEPCKSCEFREIDFGGCRCQA 326 Bradyrhizobium diaz...
Q9EXU8   253 MGGWGRVGLNVTPSGRVLPCHAAETIPsLSFENVR-ENSLSSIWYESNAFNAYRGEDWMPELCRSCERKKVDFGGCRCQA 331 Sinorhizobium melil...
P59749   240 MDGWGSTQLTVTPAGDVLPCPAAYAITtLPVENAL-RRPLSEIWYASRSFNAYRGTGWMREPCRTCPERHADHGGCRCQA 318 Streptomyces rochei
Q9I2C0   250 MGGWASVFLDITPDGTALPCHSARQLP-VQFPNVR-EHSLRHIWYESFGFNRYRGDAWMPEPCRSCEEKERDHGGCRCQA 327 Pseudomonas aerugin...
P07782   243 MNGWGKIFFTVAPDGMALPCHAARQLP-ISFPNVR-EHKLSDIWYKSTGFNHFRGDAWMPEGCRSCPDKDRDFGGCRCQA 320 Acinetobacter calco...
CAB83201 237 MGGWGQRFVNVTPSGRVLPCHAAEIIPdVSFPNVK-DVTLSEIWNISPLFNMFRGTDWMPEPCRSCERKERDWGGCRCQA 315 Gluconobacter oxydans
P27507   324 FMLTGSADNADPVCSKSPHHHKILEARREAACSDIkvSQLQFRN 367 Klebsiella pneumoniae
P71517   328 LALTGDAANTDPACSLSPLHAKMRDLAKEEAAETP--PDYIYRS 369 Methylobacterium extorquens AM1
Q89FG1   327 FALTGDAANTDPACALSPLHETIFKQAEREAEGET--NRFLYRN 368 Bradyrhizobium diazoefficiens USDA 110
Q9EXU8   332 MALAGDASATDPVCIRSPLRDRLTLEVEQLSAPSV--VPMNYRG 373 Sinorhizobium meliloti 1021
P59749   319 FQLTGDAAATDPACGLSPHRSLVDAALAEVTDGPV--PAFVPRG 360 Streptomyces rochei
Q9I2C0   328 FLLTGDADATDPVCAKSARHDLILAARRQAEEAPLglDALTWRN 371 Pseudomonas aeruginosa PAO1
P07782   321 YMLTGDAANADPVCGKSPYHQMIEQARAESQLVAPl-QNLVFRN 363 Acinetobacter calcoaceticus
CAB83201 316 LALTGNAANTDPICSLSPFTILWNRQGVKKQNLSI--GGGKVRS 357 Gluconobacter oxydans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap