Conserved Protein Domain Family
cyd_oper_ybgT

?
TIGR02106: cyd_oper_ybgT 
cyd operon protein YbgT
This model describes a very small (as short as 33 amino acids) protein of unknown function, essentially always found in an operon with CydAB, subunits of the cytochrome d terminal oxidase. It begins with an aromatic motif MWYFXW and appears to contain a membrane-spanning helix. This protein appears to be restricted to the Proteobacteria and exist in a single copy only. We suggest it may be a membrane subunit of the terminal oxidase. The family is named after the E. coli member YbgT (SP|P56100). This model excludes the apparently related protein YccB (SP|P24244). [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 211715
Aligned: 6 rows
Threshold Bit Score: 44.0923
Created: 8-Oct-2014
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAE39306      1 MWYFSWILGLSLACAFGILNAMWFELREGH 30  Bordetella parapertussis
CAC82703      1 MWYFAWILGTLLACSLGVITALALEQSEAT 30  Erwinia chrysanthemi
WP_005925423 40 MWYFAWILGTGLAALAAVLNGMWFEAREpk 69  Xanthomonas axonopodis
KDV06524      1 MWYFSWLLGLPLAAAFAVLNAMWYELMDDR 30  Brucella suis 1330
WP_017027641  1 MWYFAWILGVLLACAFGIINALWLEHTEMM 30  Vibrio breoganii
WP_023214132  1 MWYFAWILGTLLACAFGIITALALEHVEAG 30  Salmonella enterica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap