2P58


Conserved Protein Domain Family
III_needle

?
TIGR02105: III_needle 
Click on image for an interactive view with Cn3D
type III secretion apparatus needle protein
Type III secretion systems translocate proteins, usually virulence factors, out across both inner and outer membranes of certain Gram-negative bacteria and further across the plasma membrane and into the cytoplasm of the host cell. This protein, termed YscF in Yersinia, and EscF, PscF, EprI, etc. in other systems, forms the needle of the injection apparatus. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis]
Statistics
?
PSSM-Id: 131160
View PSSM: TIGR02105
Aligned: 6 rows
Threshold Bit Score: 78.6271
Threshold Setting Gi: 488145120
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2P58_B       13 ADLDAVAQTLKKPADDANKAVNDSIAALkDKPDNPALLADLQHSINKWSVIYNINSTIVRSXKDLXQGILQKF 85  Yersinia pestis
WP_001053840  1 MNLSEITQQMGEVGKTLSDSVPELLNST-DLVNDPEKMLELQFAVQQYSAYVNVESGMLKTIKDLVSTISNRS 72  Escherichia
WP_001539914 18 MDIAQLVDMLSHMAHQAGQAINDKMNGN-DLL-NPESMIKAQFALQQYSTFINYESSLIKMIKDMLSGIIAKI 88  Salmonella enterica
WP_000796272  6 GYIMDISKQFDQGVDDLNQQVEKALEDLaTNPSDPKFLAEYQSALAEYTLYRNAQSNVVKAYKDLDSAIIQNF 78  Enterobacteriaceae
Q01247       14 ADLDAVAQTLKKPADDANKAVNDSIAALkDTPDNPALLADLQHSINKWSVIYNISSTIVRSMKDLMQGILQKF 86  Yersinia enterocolitica
WP_002216328  1 MQISSPMGQLTNDIQQARQAYQNQMAAV-NI-NDPEQMLTSQFTMNQYSAFLDFKSIEMKMINDIRNRILSRI 71  Yersinia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap