Conserved Protein Domain Family
MJ0042_CXXC

?
TIGR02098: MJ0042_CXXC 
MJ0042 family finger-like domain
This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Statistics
?
PSSM-Id: 131153
View PSSM: TIGR02098
Aligned: 10 rows
Threshold Bit Score: 53.1399
Threshold Setting Gi: 15811180
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAL08850       1 MRIECKNCKAVYRIDNSKIPINGKkvKVKCTNCNTTWMHI 40  heartwater rickettsia
AAQ58657       3 YTTQCPNCQTRFKVNDSQLAAADG--LVRCGRCSHVFKAP 40  Chromobacterium violaceum ATCC 12472
Q60347         1 MNVKCPECGAWIYVVEEDSGGDAM--EVKCPKCGTSIYVV 38  Methanocaldococcus jannaschii DSM 2661
AAO22908       1 MRFVCDSCRAQYMISDDKIGPKGV--KVRCKKCGHTITVR 38  Myxococcus xanthus
Q9ZDX1         1 MYITCPNCKTQFIVTSNQIGINGR--RVKCSKCKHLWYQK 38  Rickettsia prowazekii str. Madrid E
BAC46654       7 MHIVCPHCTTSYAIKLASLGANGR--TVRCSRCKQTWVAY 44  Bradyrhizobium diazoefficiens USDA 110
WP_024265776   9 MILTCPECASRYFVDDSKVGPDGR--VVRCASCGNRWTAF 46  Caulobacter vibrioides
WP_010955430   5 FVTQCPHCQTSFRVTHHQLGVARG--VVRCGHCLQVFNAA 42  Pseudomonas putida
WP_003125407   5 VITQCPHCSTSFRVNDAQLGAANG--AVRCGTCLKVFNAL 42  Pseudomonas aeruginosa
WP_021156261   7 LAARCPACHTAFRVVADQLRLRGG--LVRCGRCNHVFDGR 44  Ralstonia solanacearum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap