1VBV


Conserved Protein Domain Family
yccV

?
TIGR02097: yccV 
Click on image for an interactive view with Cn3D
hemimethylated DNA binding domain
This model describes the small protein from E. coli YccV and its homologs in other Proteobacteria. YccV is now described as a hemimethylated DNA binding protein. The model also describes a domain in longer eukaryotic proteins.
Statistics
?
PSSM-Id: 131152
View PSSM: TIGR02097
Aligned: 10 rows
Threshold Bit Score: 140.971
Threshold Setting Gi: 4335771
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1VBV_A           3 ASKFGIGQQVRHSLLGYLGVVVDIDPVYSLSEPSPDELAVN-DEL-RAAPWYHVVMEDDNGLP-VHTYLAEAQLSSELQD 79  Escherichia coli
P75875          20 ASKFGIGQQVRHSLLGYLGVVVDIDPVYSLSEPSPDELAVN-DEL-RAAPWYHVVMEDDNGLP-VHTYLAEAQLSSELQD 96  Escherichia coli
CAD83481         3 ASKFKIGQQVRHKLLGYLGVVIDIDPEYSLEKPTLDEVTKN-DSL-RKFPWYHVVMEDDEGKP-IHTYLAEIQLGYEDTV 79  Candidatus Bl...
O94952         500 DVCYSIGLIMKHKRYGYNCVIYGWDPTCMMGHEWIRNMNVHsLPHgHHQPFYNVLVEDGSCR-----YAAQENLEYNVEP 574 human
CAC42355        41 HVEFRVGDVITHTKLNFRGVIIGWDEHAIAPEKFLKVAHGEnKNY-ATQPNYAVLIDTRDRLTpQLSYIVQENLEIDKG- 118 Caenorhabditi...
WP_010909441    70 TAKFAIGQVVRHRLFPFRGIIFDVDPQFANTDEWYEAIPADvRPR-KDQPFYHLLAENSETE--YIAYVSEQNLLEDRSG 146 Mesorhizobium...
WP_003528052     5 NAKFEIGQVVRHRMFPFRGVVFDVDPEYANTEEWWNAIPQEiRPE-KDQPFYHLFAENDESE--YVAYVSEQNLVSDDSD 81  Sinorhizobium...
WP_010919487     5 lAKFAIGQVVRHRIFPFRGVVFDVDPVFANTEEWWQSIPEDiRPT-KDQPFYHLLAENEDNS--YVAYVSEQNLLPDDSG 81  Caulobacter v...
WP_006314310     5 DAKFTLGEIVRHKVFPFRGVVIDVDPEYANTEEWWNAIPAEiRPE-RDQPFYHLLAENEETE--YVAYVSEQNLVHDEND 81  Agrobacterium
TIGR:At2g03390  93 EYAFRLGQKLRHKTFGYRAVVCGMDPICSESSSWMEAAEVEkLPRgSNQPFYQVLVDVRTHPDlLVAYVAEDNLLAPEKP 172 thale cress
1VBV_A          80 --EHPEQPSMDELAQTIRKQLQAPR 102 Escherichia coli
P75875          97 --EHPEQPSMDELAQTIRKQLQAPR 119 Escherichia coli
CAD83481        80 --IHPEQSTLDDLAESIRLQLQTPR 102 Candidatus Blochmannia floridanus
O94952         575 --QEISHPDVGRYFSEFTGTHYIPN 597 human
CAC42355       119 ---TVMHPLVDKFFDGFDEKRQKLV 140 Caenorhabditis elegans
WP_010909441   147 --EPVRHPQIKEMFDKRPDGRYEPK 169 Mesorhizobium loti
WP_003528052    82 --RPIRHPQVDALFEKADAGHYKPK 104 Sinorhizobium/Ensifer group
WP_010919487    82 --EPIGHPQTAVIFESFDHGLYKLR 104 Caulobacter vibrioides
WP_006314310    82 --TPLRNPNIGRIFDKAPNGEWRPK 104 Agrobacterium
TIGR:At2g03390 173 dkERFDHPYISFLYYGADTAGDFIP 197 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap