Conserved Protein Domain Family
meth_trns_rumB

?
TIGR02085: meth_trns_rumB 
23S rRNA (uracil-5-)-methyltransferase RumB
This family consists of RNA methyltransferases designated RumB, formerly YbjF. Members act on 23S rRNA U747 and the equivalent position in other proteobacterial species. This family is homologous to the other 23S rRNA methyltransferase RumA and to the tRNA methyltransferase TrmA. [Protein synthesis, tRNA and rRNA base modification]
Statistics
?
PSSM-Id: 131140
View PSSM: TIGR02085
Aligned: 4 rows
Threshold Bit Score: 693.121
Threshold Setting Gi: 20455420
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P44083   3 DCRYYQQNECRSCQWLEIPCSQQLTEKQYHLKQQLIsiNYDEAQWVAPFQSNQQGFRNKAKMVVSGSVERPILGILKNPN 82  Haemophilus influenza...
P75817   2 QCALYDAGRCRSCQWIMQPIPEQLSAKTADLKNLLA--DFPVEEWCAPVSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDG 79  Escherichia coli K-12
Q8ZGG1   2 HCAQYTAGRCRSCQWLDKPYPQQLADKQHHLESLLA--GHAVTQWLAPVFGRESAFRNKAKMVVSGSVERPLLGMLHRDG 79  Yersinia pestis
Q9KL20   2 QCEFFIQKRCTSCHLCAQPYSEQVTNKDQQLRELIAp--ATDVQWLPPVTSADTAFRNKAKMVVLGAAHAPILGIEDAQG 79  Vibrio cholerae O1 bi...
P44083  83 DPqsaIDLCDCPLYPTHFSAIFSILKDFIGRAGLVPYNIAKQKGELKYILLTESIATEKLMLRFVLRTENKLPLIRRELP 162 Haemophilus influenza...
P75817  80 TP---EDLCDCPLYPASFAPVFAALKPFIARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSDTKLAQLRKALP 156 Escherichia coli K-12
Q8ZGG1  80 TP---VDLCACPLYPPSFEPVFTVLKTFIARAGLTPYNVARKRGELKFLLLTESTYNGELMLRFVLRSETKLAQLIAALP 156 Yersinia pestis
Q9KL20  80 QP---LSLVTCPLYPQPMQELLAYLENWIRIAGIPPYNKLKKKGELKFILLTRSENSGQFMLRFVARSHAVLERIERNLP 156 Vibrio cholerae O1 bi...
P44083 163 KLLEKLPHLEVISINLQPQHAAILEGEQEIFLTEQQFLPENFNGIPLFIRPRGFFQTNPKVAAGLYATAQQWVAEFPIYN 242 Haemophilus influenza...
P75817 157 WLHEQLPQLKVITVNIQPVHMAIMEGETEIYLTEQQALAERFNDVPLWIRPQSFFQTNPAVASQLYATARDWVRQLPVKH 236 Escherichia coli K-12
Q8ZGG1 157 WLQQQLPQLAVISANIQPVHMAILEGEREIPLTEQQALPERFNQVPLYIRPQSFFQTNPQVAASLYATARQWVQEHEVHS 236 Yersinia pestis
Q9KL20 157 TLIAAFPMIEVISVNIQPVHMARLEGEEEIFLTETQSLLEHFNDVPMVIRPKSFFQTNPKVAEQLYATARTWVREIAPTQ 236 Vibrio cholerae O1 bi...
P44083 243 LWDLFCGVGGFGLHCAkalqekwGKPIKLTGIEISSSAILAASHSAKILGLEHVNFQSLDAASVIENKNeNKPDLVIVNP 322 Haemophilus influenza...
P75817 237 MWDLFCGVGGFGLHCA-------TPDMQLTGIEIASEAIACAKQSAAELGLTRLQFQALDSTQFATAQG-DVPELVLVNP 308 Escherichia coli K-12
Q8ZGG1 237 MWDLFCGVGGFGLHCA-------GPETQLTGIEINAEAIACARQSAEQLGLKNVSFAALDSTRFATAEA-QIPELVLVNP 308 Yersinia pestis
Q9KL20 237 MWDLFCGVGGFALHCA-------APDTAVTGIEIEPEAIASAQRSAQMMGIDNLSFAALDSAKFSQSQM-SAPELVLVNP 308 Vibrio cholerae O1 bi...
P44083 323 PRRGIGKELSEFLNQIQPHFILYSSCNAMTMGKDLQHLTCYKPLKIQLFDMFPQTSHYEVLVLLER 388 Haemophilus influenzae Rd KW20
P75817 309 PRRGIGKPLCDYLSTMAPRFIIYSSCNAQTMAKDIRELPGFRIERVQLFDMFPHTAHYEVLTLLVK 374 Escherichia coli K-12
Q8ZGG1 309 PRRGIGRELCDYLSQMAPKFILYSSCNAETMAKDISLLAGYHIERVQLFDMFPHTSHYEVLTLLTL 374 Yersinia pestis
Q9KL20 309 PRRGLGSELTAQLEALAPKYILYSSCNPQTMVKDIAELSSYQMIRVQWFDMFPHTDHAEVLTLLVR 374 Vibrio cholerae O1 biovar El Tor st...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap