Conserved Protein Domain Family
leud

?
TIGR02084: leud 
3-isopropylmalate dehydratase, small subunit
Homoaconitase, aconitase, and 3-isopropylmalate dehydratase have similar overall structures. All are dehydratases (EC 4.2.1.-) and bind a Fe-4S iron-sulfur cluster. 3-isopropylmalate dehydratase is split into large (leuC) and small (leuD) chains in eubacteria. Several pairs of archaeal proteins resemble the leuC and leuD pair in length and sequence but even more closely resemble the respective domains of homoaconitase, and their identity is uncertain. The members of the seed for this model are those sequences which are gene clustered with other genes involved in leucine biosynthesis and include some archaea. [Amino acid biosynthesis, Pyruvate family]
Statistics
?
PSSM-Id: 131139
View PSSM: TIGR02084
Aligned: 5 rows
Threshold Bit Score: 293.237
Threshold Setting Gi: 8134550
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O67399     7 GRVWKFGDNVDTDQIIPARYLNTSDPYELAKHVMEDSEHpEF-AKEHKEGDIIVAGKNFGSGSSREHAPIAIKYSGVPVV 85  Aquifex aeolicus VF5
Q97EE1     5 GDVLKYGDNIDTDVIIPARYLNTSVPEELAKHCMEDLDV-DF-LKKLKTGDIVVGGRNFGCGSSREHAPICIKAAGVSCV 82  Clostridium acetobu...
Q8RDK1     3 GKAIKYGDNIDTDVIIPARFLNTSDPKELAEHCMEDLDR-EF-KNKVKEGDILVVGENFGCGSSREHAPLAIKASGISCI 80  Caldanaerobacter su...
AAP77732   5 GFVHKYGDNVDTDVIIPARYLNTADHKELANHCMEDIDK-DF-VAKVKEGDIMVGGWNFGCGSSREHAPIAIKASGISCI 82  Helicobacter hepati...
Q9WZ25     7 GKVFVFGDNVNTDEIIPARYLNTSDPQELAKYCMEDARP-GFgRRDDIKGSIIVAGENFGCGSSREHAPVAIKAAGISCV 85  Thermotoga maritima...
O67399    86 IAKSFARIFFRNAINIGLPIVEAPEAVDEIEHGDEIEVDLEKGVIKNLRTGKEYQATKFPKELQDILKAGGLMAYAKE 163 Aquifex aeolicus VF5
Q97EE1    83 IAKSFARIFYRNSINIGFPILECEEAVNDASTGDKLEVDFIEGIIKNVTLNKEYKAQPFPDFMLKIMKNEGLTNCVKK 160 Clostridium acetobuty...
Q8RDK1    81 IAKSFARIFYRNAINIGLPILESREAVDGIEEGDIVSVDVDNGIIRNVTKGTEFKAQPFPEFIKEIIKYGGLINYVRE 158 Caldanaerobacter subt...
AAP77732  83 IAKSFARIFYRNAINIGLAIIESEEVAQSLENGDEVAIDFDKGIITNCKNNQQFSTTPFPPFIQEIINANGYLNWISK 160 Helicobacter hepaticu...
Q9WZ25    86 IAKSFARIFFRNAINIGLPIVELKEA-DEFEEGDIAEVDLENGVVRNLTKGKEYRIRPYPEFLMKIMEAGGWLEYCLK 162 Thermotoga maritima MSB8
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap