Conserved Protein Domain Family
LEU2

?
TIGR02083: LEU2 
3-isopropylmalate dehydratase, large subunit
Homoaconitase, aconitase, and 3-isopropylmalate dehydratase have similar overall structures. All are dehydratases (EC 4.2.1.-) and bind a Fe-4S iron-sulfur cluster. 3-isopropylmalate dehydratase is split into large (leuC) and small (leuD) chains in eubacteria. Several pairs of archaeal proteins resemble the leuC and leuD pair in length and sequence but even more closely resemble the respective domains of homoaconitase, and their identity is uncertain. These homologs are described by a separate model of subfamily (rather than equivalog) homology type (TIGR01343). This model along with TIGR00170 describe clades which consist only of LeuC sequences. Here, the genes from Pyrococcus furiosus, Clostridium acetobutylicum, Thermotoga maritima and others are gene clustered with related genes from the leucine biosynthesis pathway. [Amino acid biosynthesis, Pyruvate family]
Statistics
?
PSSM-Id: 131138
View PSSM: TIGR02083
Aligned: 4 rows
Threshold Bit Score: 752.032
Threshold Setting Gi: 22001732
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8U2A1     4 MTIAEKILATHAGKEEVKPGEIVLAKVDFMFGNDVTTPLAIKTFRKIGVEKVFDPERIAIVLDHFTPNKDIKAAEQCKFS 83  Pyrococcus furiosus...
Q97EE0     5 MTMTQKILANHAGLDYVEAGQLITANLDLVLGNDVTTPVAVKAFKTMGTNKVFDKKKVAIVPDHFTPNKDIKSAEHCKMI 84  Clostridium acetobu...
AAP77733   3 MTMSQKILADRAGLESVRPNDLIMAKLDMVLGNDITTPVAINAFKEAKFQKVFDKDKISLVMDHFAPNKDIKAATQSAQC 82  Helicobacter hepati...
Q9WZ24     1 MTLAEKILSQKAGRK-VEPGEFLLLEPDIALANDITAPLAIKKFKEYGGKKVKYPDRVVLVPDHFTPNKDIKSAMQVKMM 79  Thermotoga maritima...
Q8U2A1    84 REFAREQGIKWFFEGGNVGVEHCLLPELGLVLPGELIIGADSHTCTYGALGAFATGVGSTDLAVAMATGEAWFRVPETIK 163 Pyrococcus furiosus...
Q97EE0    85 RQFAKSKEIENYFEIGEMGIEHALIPEKGLAVPGDVIIGADSHTCTYGALGVFSTGVGSTDMAVGMATGKAWFKVPEAIK 164 Clostridium acetobu...
AAP77733  83 RCFAKDFDISHYYDVGNMGVEHALLPEQGIVTIGDLIIGADSHTCTYGALGAFSTGVGSTDMAVGMATGQAWFKVPYAIK 162 Helicobacter hepati...
Q9WZ24    80 REFAREQGIEKFFEIGRMGIEHVLLPEEGIVKSGDLVVGADSHTCTYGALGAFATGVGSTDIAGFYLIGKVWFRVPESIK 159 Thermotoga maritima...
Q8U2A1   164 FVYEGDLQPWVTSKDLILYTIGDIGVNGALYKVMEFSGEVIEKLSVEQRMTMTNMAIEAGAKTGIIEPDKKTIEYVKGRA 243 Pyrococcus furiosus...
Q97EE0   165 FVLKGKPAKWVSGKDIILHIIGMIGVDGALYKSMEYTGDGLEYLSMDDRFTIANMAIEAGAKNGIFPVDEKTIEYMKGRS 244 Clostridium acetobu...
AAP77733 163 FNLKGKLRPYVSGKDVILHIIGKIGVDGALYKSMEFGGEGLKNLTIDDRLCIANMAIEAGAKNGIFEVDDITISYAKGRT 242 Helicobacter hepati...
Q9WZ24   160 VTLRGKFKDLVTAKDLVLKLISILGVDGANYKAIEFSGPGVKEISMDGRFTISNMAIEAGGKTGLFPVDEITIAYERERG 239 Thermotoga maritima...
Q8U2A1   244 KREYKIYKSDEDAKYYKVIEYDVSKIEPQVAFPHLPENTVPISKAAkmNIKIDQVVIGSCTNGRLEDLRMAAEVLEGQKV 323 Pyrococcus furiosus...
Q97EE0   245 DRELKKFDADEDAEYSRVIEIDLSTLKPTVAFPHLPENTKTIDQVG--EVNVDQVVIGSCTNGRMEDLRIAASILKGKKI 322 Clostridium acetobu...
AAP77733 243 KRDFRIYKADVDAEYEQVFDIDLDSINHTVAFPHLPENTKEKDDWG--EIKIDQVVIGSCTNGRLSDMAVAAEILKDKTI 320 Helicobacter hepati...
Q9WZ24   240 IEVEEMYP-DEDAKYVREVEMDLSELEPQVAYPFLPSNAKDVSEAEkeRIKIDQAVIGSCTNGRIEDLRLAAQILKGRTV 318 Thermotoga maritima...
Q8U2A1   324 APWVRLIILPCSPTVYFKAMKEGLLEIFLEAGAVIGPPTCGPCLGGHMGILASGERAVSTTNRNFVGRMGHPKSEVYLAS 403 Pyrococcus furiosus...
Q97EE0   323 KKGIRLIVFPGTQNIYLEAMEEGLVRTFIEAGGIVSTPTCGPCLGGHMGILAEGERAISTTNRNFVGRMGHPKSEVYLAS 402 Clostridium acetobu...
AAP77733 321 AKNTRCIIIPATQNIYLECINRGYLETFIKAGAVVSTPTCGPCLGGHMGILAANEKCVSTTNRNFVGRMGHITSEVYLSS 400 Helicobacter hepati...
Q9WZ24   319 SPDVRCIIIPGSQKVYKQALKEGLIDIFIDAGCAVSTPTCGPCLGGHMGVLAEGEVAISTTNRNFVGRMGHPNSKVFLAS 398 Thermotoga maritima...
Q8U2A1   404 PYVAAASAILGRIASPEEV 422 Pyrococcus furiosus DSM 3638
Q97EE0   403 PAVAAASAIAGKIVSPEEV 421 Clostridium acetobutylicum ATCC 824
AAP77733 401 PEVAAASAVRGILSAPQDI 419 Helicobacter hepaticus ATCC 51449
Q9WZ24   399 PAVAAASAIKGYIADPRKL 417 Thermotoga maritima MSB8
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap