1CS1


Conserved Protein Domain Family
O_succ_thio_ly

?
TIGR02080: O_succ_thio_ly 
Click on image for an interactive view with Cn3D
O-succinylhomoserine (thiol)-lyase
This family consists of O-succinylhomoserine (thiol)-lyase, one of three different enzymes designated cystathionine gamma-synthase and involved in methionine biosynthesis. In all three cases, sulfur is added by transsulfuration from Cys to yield cystathionine rather than by a sulfhydrylation step that uses H2S directly and bypasses cystathionine. [Amino acid biosynthesis, Aspartate family]
Statistics
?
PSSM-Id: 131135
View PSSM: TIGR02080
Aligned: 6 rows
Threshold Bit Score: 661.496
Threshold Setting Gi: 503610887
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1CS1_A         2 TRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRALAELEGGAGAVLTNTGMSAIH 81  Escherichia coli
P00935         2 TRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRALAELEGGAGAVLTNTGMSAIH 81  Escherichia col...
WP_000213241   3 TRKPATIAVRTGIESDTQYHAVVPPIYLSTNYGFPAFGEVPKYDYTRSGNPNRGLLEQTLYELECGEGAVVTNCGTSAIN 82  Vibrio cholerae
CAD83273       2 KNNKSTVSVRSGLNNDKQHGCVVSPITLSTTYNFFEFNKPRLYDYSRRKNPTRDIVQKTVADLEQGKNAIITSSGMSAIY 81  Candidatus Bloc...
WP_011073769   9 eRQLATLAVRQGIESDTQYGAVVPPIYLSTNYAFDGHKNPREFDYSRSGNPTRSILGDALAKLEKGATGVVTCTGMAAIT 88  Shewanella onei...
WP_013844963   8 SDRAETTAAAHGVATDPAFGSVVPPLYLSSTYEFAGFDTPRAYDYGRSGNPTRDLLAQALAKLEGGADAVVTPSGMAA-L 86  Sinorhizobium m...
1CS1_A        82 LVTTVFLKPGDLLVAPHDCYGGSYRLFDSLAKRGCYRVLFVDQGDEQALRAALAEK-PKLVLVESPSNPLLRVVDIAKIC 160 Escherichia coli
P00935        82 LVTTVFLKPGDLLVAPHDCYGGSYRLFDSLAKRGCYRVLFVDQGDEQALRAALAEK-PKLVLVESPSNPLLRVVDIAKIC 160 Escherichia col...
WP_000213241  83 LWVTALLGPDDLIVAPHDCYGGTYRLLNTRAKKGDFKVQFVDQSNAAALTQALARK-PKLLLIETPSNPLVRVVDIAHLC 161 Vibrio cholerae
CAD83273      82 LICIALLNSDDCLIAPYDCYGGTYRLLNALNSKKVCRVQFVNQNDTELMLKCLKQKdVKLVFIETPSNPMLRVVDIRYMC 161 Candidatus Bloc...
WP_011073769  89 LVTT-LLGPDDLLVVPHDCYGGSYRLFTNLAKKGQFKLLVVDQTDNQALAQAIAQQ-PKMVWIETPSNPLLRVVDIEAIA 166 Shewanella onei...
WP_013844963  87 DLLLGRLRRNHLVLAPHDCYGGTLRLLKARADLGHLTFRLTDQRDFGGFEAALSDA-PALVLIESPSNPLMRVTDIARLS 165 Sinorhizobium m...
1CS1_A       161 HLAREVGAVSVVDNTFLSPALQNPLALGADLVLHSCTXYLNGHSDVVAGVVIAKDPDVVTELAWWANNIGVTGGAFDSYL 240 Escherichia coli
P00935       161 HLAREVGAVSVVDNTFLSPALQNPLALGADLVLHSCTKYLNGHSDVVAGVVIAKDPDVVTELAWWANNIGVTGGAFDSYL 240 Escherichia col...
WP_000213241 162 QLAKAQGTLVAVDNTFLTPVFQKPLTLGADFVLHSTTKYINGHSDVIGGVLICKHKQHAEELAWWGNCLGSTGTPFDSYM 241 Vibrio cholerae
CAD83273     162 SLKERDDIVYVVDNTFMTPIFQNPLNLGADLVVHSCSKYLNGHSDVILGAVISKDIYLHEKLMWWSNALGITGGAFDSYQ 241 Candidatus Bloc...
WP_011073769 167 KASHGVGALVVVDNTFLSPILQQPLLLGADIVIHSTTKYINGHSDVVGGAVIAKDPQIGETLHWWSNTLGLTGSAFDSYQ 246 Shewanella onei...
WP_013844963 166 TLAKAAGSAVAVDNTFLSPALQQPLSLGADYAIHSATKFLNGHSDVIAGAVIAAEPQEAHDLKRWANVTGAVAAPFDAWL 245 Sinorhizobium m...
1CS1_A       241 LLRGLRTLVPRMELAQRNAQAIVKYLQTQPLVKKLYHPSLPENQGHEIAARQQKGFGAMLSFELDGDEQTLRRFLGGLSL 320 Escherichia coli
P00935       241 LLRGLRTLVPRMELAQRNAQAIVKYLQTQPLVKKLYHPSLPENQGHEIAARQQKGFGAMLSFELDGDEQTLRRFLGGLSL 320 Escherichia col...
WP_000213241 242 TLRGIRTLGARMRVHEESAQQILAYLQTQSLVSKIYHPSLPDHPGHEIAKKQQSGFGAMLSFEFAGSFEQLKFFVGKLAL 321 Vibrio cholerae
CAD83273     242 LLRGIRTLSIRVCQQQCNTKNIVDFLLKQPQIKSIYYPGLYSHVGYKIACQQQTGFGSIFSFELKGTEGVVSKFLKSLKL 321 Candidatus Bloc...
WP_011073769 247 TLRGLRTLAVRIREHQRNAQRIVELLSNSPVVSKVYYPGLADHPGHAIAAKQQKGFGAMLSFELKGGEAEVVAFLDALSL 326 Shewanella onei...
WP_013844963 246 TLRGLRTLFARMSSQERSAMTIAEYLDAHPAVRHVHYAGLPDHADHEVARRQQRGFGAMMSFELEGGVPAVRRFLAHIRC 325 Sinorhizobium m...
1CS1_A       321 FTLAESLGGVESLISHAATMTHAGMAPEARAAAGISETLLRISTGIEDGEDLIADLENGFRAA 383 Escherichia coli
P00935       321 FTLAESLGGVESLISHAATMTHAGMAPEARAAAGISETLLRISTGIEDGEDLIADLENGFRAA 383 Escherichia coli K-12
WP_000213241 322 FSLAESLGGVESLICHPASMTHRAMGEEALAEAGISQQLLRLSVGLEDASDLIADLDQAFLHT 384 Vibrio cholerae
CAD83273     322 FTLAESFGGVESLIAHPETMTHAAMSKQSRDTAGINNMLLRVSVGLEDSVDLINDLDQALQSI 384 Candidatus Blochmannia floridanus
WP_011073769 327 FSVAESLGGVESLVAVPATMTHRAMEPQARFEAGIKDTLLRLSVGIEDADDLVADIQAGLAAV 389 Shewanella oneidensis
WP_013844963 326 FTLAESLGGVESLVAHPATMTHLDMGPEARERAGIRDELLRLSIGLEHIDDLMEGLELGLGAC 388 Sinorhizobium meliloti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap