Conserved Protein Domain Family
AspKin_pair

?
TIGR02078: AspKin_pair 
Pyrococcus aspartate kinase subunit, putative
This family consists of proteins restricted to and found as paralogous pairs (typically close together) in species of Pyrococcus, a hyperthermophilic archaeal genus. Members are always found close to other genes of threonine biosynthesis and appear to represent the Pyrococcal form of aspartate kinase. Alignment to aspartokinase III from E. coli shows that 300 N-terminal and 20 C-terminal amino acids are homologous, but the form in Pyrococcus lacks ~ 100 amino acids in between. [Amino acid biosynthesis, Aspartate family]
Statistics
?
PSSM-Id: 131133
View PSSM: TIGR02078
Aligned: 5 rows
Threshold Bit Score: 502.014
Threshold Setting Gi: 499321698
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011012190   5 PVVVKFGGTSVRYAFEEALELVANLNENTRTIVVVSALAGVTDCLLRLANG-DMSALLEIEEIHEELSQELDVQLDHLMY 83  Pyrococcus furi...
WP_010868158   4 MIVLKFGGSSVKNDFHEAVSLTKSIFEEKEVAVVVSALKGITDMLIKYAKTfDSKYAIKIADSYVKFARTNGVDPNILSP 83  Pyrococcus abyssi
WP_010885172   7 MIVIKFGGSSLRSEFKSAVSLIKALSEEKDVVVVVSALKGITDLLEKYTDTfDSRYAVEVSKTYLEFGKRMGIDTSSLSP 86  Pyrococcus hori...
WP_011012189   1 MIVLKFGGSSIKYDFEEATNLALSLFEDDAVIVVVSAIKGITDKLILYSQTlDKTIATKIASEYVSFAKSHGIDPVILKP 80  Pyrococcus furi...
WP_010868157   5 LLVVKFGGSSVRYAFEEALELVKYLSERIPIVVVVSALKGVTDELIRFANG-DKGALPRIERIHEEF-------LNYHGL 76  Pyrococcus abyssi
WP_011012190  84 QLHKTLNS-KSsFPsKEAFVDEIASFGERFSAELFSEGlkilgINAKAVDSKDILFAKGDYGNAEVDFKKSVYGAGILYR 162 Pyrococcus furi...
WP_010868158  84 HIQELFNP-PS-LP-KDALTDYILSIGELLSAVIFAEV-----VEGQVIYPWELFSAYGKFGDGFIDLKKSKKNAKIIYE 155 Pyrococcus abyssi
WP_010885172  87 YLKQLFNP-PD-LP-PQALRDYILSIGELLSAAMIAEK-----ANGAVIFPWDLFVAHGSFGNGFIDIKKSKRNVKLVKE 158 Pyrococcus hori...
WP_011012189  81 YLDELFNL-PD-LP-EEALRDYILSLGEVLSAVIFSAS-----IGGKFVPSWDIFEAEGNFGNAFIDIKSSKKKFKRVFE 152 Pyrococcus furi...
WP_010868157  77 NTKISISFrKD-MP-PEALRDEIISLGERISAKIFAEGlellgIKSKVVDPLEFLIAKGEFGDAYINIQESKRRAGKLIR 154 Pyrococcus abyssi
WP_011012190 163 MLRRGIVPVVTGYYGNLNGFRATFGRGGSDYSATSIARLVNAKATLIMSDVEGIYTADPKLVPSAKLIHYISYREAKIAA 242 Pyrococcus furi...
WP_010868158 156 VIDSGKIPIVPGFVGGMDGYRVTLGRGGSDYSAVALGVILNSELVAIMSNVEGIFTADPKLVPSARLIPYLSYEEALIAA 235 Pyrococcus abyssi
WP_010885172 159 ALESGKIPIIPGFIANLNGYRVTLGRGGSDYSAVALGVLLNSELVAIMSDVEGIFTADPKMIPYSLLIPYMSYDEILIAS 238 Pyrococcus hori...
WP_011012189 153 VLEEGYIPVIPGFTAGKDGYILTLGRGGSDYSGVAAGVLGKAKLVAIMSDVEGIYTADPKLVPSARLIPYVSYDEIIISS 232 Pyrococcus furi...
WP_010868157 155 LIKSGVIPVIPGFYGNLNGFRVTFGRGGSDYSATALARILDSRCVLIMSDVEGIFTADPKLVPSARLIPYLSYEEIKVAA 234 Pyrococcus abyssi
WP_011012190 243 KLGMKALHHRAIDPVEG-RIPVILGKTRDLKFGTLISHKSQGIPVVVHKLIedhaeVSVVSTRRSFSLPy-eVYEEGDFY 320 Pyrococcus furi...
WP_010868158 236 KHGMKAIQWKAAELAKEkKILMLFGRTNNWRMGTVISNRTSRMPLMTYKDG-----LLLINVEEELEYR---VIDEGPFW 307 Pyrococcus abyssi
WP_010885172 239 KYGMEAIQWKAAKLAKEyEALILFGRASDWRMGTVVSNSSSHMPLLSYDQGk----LLVMNMDSEIPYE---VVEEGEFW 311 Pyrococcus hori...
WP_011012189 233 KHGMRALQWKAAELAKEyKIPVLFGRTRNWRMGTLMSERSSGMPLMTYKDG-----LLLVNVTEEIKYP---IIAEGPFW 304 Pyrococcus furi...
WP_010868157 235 KLGMKALHWKAVDPVVG-DIPIIFGKTKDWKFGTIVLNARSNFPIIVHRVRedfaeIFVVG--RNISLPgflVEEEREDF 311 Pyrococcus abyssi
WP_011012190 321 FKIKIPKEQFLEVLKDIHRRVV 342 Pyrococcus furiosus
WP_010868158 308 KLYDVPGNEGIRIIRELHKAIF 329 Pyrococcus abyssi
WP_010885172 312 RVYRVPKRDSIKIIKELHRKII 333 Pyrococcus horikoshii
WP_011012189 305 KLYKVSQEEGIHLMRELHTKLF 326 Pyrococcus furiosus
WP_010868157 312 VKIVVAREDLPEAIREIHREVV 333 Pyrococcus abyssi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap