3MMC


Conserved Protein Domain Family
dsrB

?
TIGR02066: dsrB 
Click on image for an interactive view with Cn3D
sulfite reductase, dissimilatory-type beta subunit
Dissimilatory sulfite reductase catalyzes the six-electron reduction of sulfite to sulfide, as the terminal reaction in dissimilatory sulfate reduction. It remains unclear however, whether trithionate and thiosulfate serve as intermediate compounds to sulfide, or as end products of sulfite reduction. Sulfite reductase is a multisubunit enzyme composed of dimers of either alpha/beta or alpha/beta/gamma subunits, each containing a siroheme and iron sulfur cluster prosthetic center. Found in sulfate-reducing bacteria, these genes are commonly located in an unidirectional gene cluster. This model describes the beta subunit of sulfite reductase. [Central intermediary metabolism, Sulfur metabolism]
Statistics
?
PSSM-Id: 131121
View PSSM: TIGR02066
Aligned: 5 rows
Threshold Bit Score: 559.072
Threshold Setting Gi: 2459569
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3MMC_B    22 VIAKNYGKWKYHEVVKPGVIKRVAESGDVIYVVRFGTPR--LLSIYTVRELCDIADKYSDGYLRWTSRNNVEFFVTDESK 99  Archaeoglobus fulgi...
CAC36213  28 IVKKNYGKWKYHEIIQPGVLVHVSETGDELYSVRVGTPR--LVSVDYIREVCDIADKYCDGYVRWTTRNNIEFLVSDKSK 105 Thermodesulforhabdu...
AAC35395  22 VMRKNFGMWKYHEHPRPGVLLHVAYSGDKIWTVKAGTQR--ILDVFTLRKLCDIGDEFADGYVHFTIRSNIEYLVSDEAK 99  Allochromatium vino...
AAC46136  19 IVKRNYGKWKERKFHGPGIIEHISETGERVFTVKAALPPnaRVSVDTLEKFADIADKLGVGALRITIAGNVEFITDSLDK 98  Pyrobaculum islandi...
Q59110    22 VIAKNYGKWKYHEVVKPGVIKRVAESGDVIYVVRFGTPR--LLSIYTVRELCDIADKYSDGYLRWTSRNNVEFFVTDESK 99  Archaeoglobus fulgi...
3MMC_B   100 IDDLINEVQEr-VGFPCGGTWDAVKgeyglsNIVHTQGWIHCHTPAIDASGIVKAVMDELYEYFT-DHKLPAMCRISLAC 177 Archaeoglobus fulgi...
CAC36213 106 LQPLIDDLKSrgNWFPIGGTGASVT------NIVHTQGWVHCHTPAIDASGIVKAVMDELFEYFG-SHKLPAQVRISLAC 178 Thermodesulforhabdu...
AAC35395 100 VQPLIDALEG--AGFVVGGTQNSVA------MISHTQGWLHCDIPGTDASGVVKSMMDELIDEFR-NATMPNRVHITTSC 170 Allochromatium vino...
AAC46136  99 ALKIKEELEK--LGFPVGGWGGALWg------INTCTAFLTCQIAVIDAPSIGKALGDALKPYFTgEEKLPAKLRVFISG 170 Pyrobaculum islandi...
Q59110   100 IDDLINEVQEr-VGFPCGGTWDAVKgeyglsNIVHTQGWIHCHTPAIDASGIVKAVMDELYEYFT-DHKLPAMCRISLAC 177 Archaeoglobus fulgi...
3MMC_B   178 CANMCGAVHASDIAIVGIHRTPPIPNDEAIRKTCEIP-----------STVAACPTGALKP------DMKNKTIKVDVEK 240 Archaeoglobus fulgi...
CAC36213 179 CLNMCGAVHCSDIAILGVHRKPPFIEHERVQNVCEIP-----------LVIAACPTAAIKPkkveidGKEYKSVEINNAR 247 Thermodesulforhabdu...
AAC35395 171 CQINCGGQ--GDIAINIQHTKPPKINHDLVANVCERP-----------SVVARCPVAAIRPam---vNGK-PSLEVDERK 233 Allochromatium vino...
AAC46136 171 CPSGCAGGTAIDIAIVGMWGAPPKIREEVLPLCMPPPkalakipesqvFLVQVCPTGALTLr----rEGEKIKLVLVGEK 246 Pyrobaculum islandi...
Q59110   178 CANMCGAVHASDIAIVGIHRTPPIPNDEAIRKTCEIP-----------STVAACPTGALKP------DMKNKTIKVDVEK 240 Archaeoglobus fulgi...
3MMC_B   241 CMYCGNCYTMCPGMPLFDPENDGAAIMVGGKLSEARRMPELSKVVVPWVPNEPPRWPTLVKYVKQILEAWAANANKHERL 320 Archaeoglobus fulgi...
CAC36213 248 CMFCGNCYTMCPALPIADGDGDGIALWVGGKVSNSRVPPMFSKLAVPYIPNEPPRWPTVVQAVKKILETYASDARRYERI 327 Thermodesulforhabdu...
AAC35395 234 CICCGACYPPCPPMQINDAEHSKLAIWVGGNHSNARGKPTFQKLVAAGIPNNPPRWPEATAIVKRILKAYKEGAKDWERI 313 Allochromatium vino...
AAC46136 247 CINCGRCKDNCDAFDYD-PKDVGAAILIGGKMANTGVGPRLARVLIPWIPANPPRYEEIVAVVKKVIDVWKTHGKPGERL 325 Pyrobaculum islandi...
Q59110   241 CMYCGNCYTMCPGMPLFDPENDGAAIMVGGKLSEARRMPELSKVVVPWVPNEPPRWPTLVKYVKQILEAWAANANKHERL 320 Archaeoglobus fulgi...
3MMC_B   321 IEWVDRIGWERFFELTGLEFTQHLIDDYRITpyfYSEFRASTQFKW 366 Archaeoglobus fulgidus DSM 4304
CAC36213 328 GEWINRIGWEKFFEKTGIEFRHEHIDDYRLA---MTTWRTTTQFKW 370 Thermodesulforhabdus norvegica
AAC35395 314 NEWIERIGWPRFFEEVELPFTKYHIDTWRGAr---ASFNSSSYIRF 356 Allochromatium vinosum DSM 180
AAC46136 326 ADFVERIGWAKFVELVGAPKMAAQYLWWPDAartYLTYRARGEVIF 371 Pyrobaculum islandicum DSM 4184
Q59110   321 IEWVDRIGWERFFELTGLEFTQHLIDDYRITpyfYSEFRASTQFKW 366 Archaeoglobus fulgidus DSM 4304
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap