3L7Z,2WNR


Conserved Protein Domain Family
ECX1

?
TIGR02065: ECX1 
Click on image for an interactive view with Cn3D
archaeal exosome-like complex exonuclease 1
This family contains the archaeal protein orthologous to the eukaryotic exosome protein Rrp41. It is somewhat more distantly related to the bacterial protein ribonuclease PH. An exosome-like complex has been demonstrated experimentally for the Archaea in Sulfolobus solfataricus, so members of this family are designated exosome complex exonuclease 1, after usage in SwissProt. [Transcription, Degradation of RNA]
Statistics
?
PSSM-Id: 131120
View PSSM: TIGR02065
Aligned: 8 rows
Threshold Bit Score: 385.641
Threshold Setting Gi: 29336868
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3L7Z_B   8 KLILDDGKRTDGRKPDELRSIKIELGVLKNADGSAIFEMGNTKAIAAVYGPKEMHPRHLSLPDRAVLRVRYHMTPFST-D 86  Sulfolobus solfataric...
Q8TYC1   7 RLISEDGLRLDGRKPDEMRPLKIQAGVLKRADGSAYLELGANKIVAAVYGPRELHPRHKQKPDRAVVRFRYNMAPFSV-D 85  Methanopyrus kandleri...
O26779   9 QLKTSPSVREDGRAFDELRPLKIEAGILERADGSSYLEFGGNKILVAVYGPREAQIRKLQRPDRAVIRCRYNMAPFSV-E 87  Methanothermobacter t...
Q97BZ5  10 KLINEDNLRLDGRSFNELRPIKIEAGVLNRADGSAYIEWGGNKIIVGVYGPKEAYPKHSQDIDHAVVKARYNMAAFSV-D 88  Thermoplasma volcaniu...
Q9UXC2  11 KLILDDGKRTDGRKPDELRSIKIELGVLKNADGSAIFEMGNTKAIAAVYGPKEMHPRHLSLPDRAVLRVRYHMTPFST-D 89  Sulfolobus solfataric...
Q9YC03   9 VELIRDGRRHDGRLPEDLRPVRMQVGILHNADGSALVEFGRTRVLAAVYGPREPHQRFYVLPDRAALRVRYHMAPFST-D 87  Aeropyrum pernix K1
Q8ZVM9   6 VPLLQNGVRADGRTPDQMREVKIAVGVVSNADGSAMVSYGATTAVAAVYGPREMHPRHLSLPDRGVMRVRYHMAPFSTkD 85  Pyrobaculum aerophilu...
2WNR_B   9 QLKTSPSVREDGRAFDELRPLKIEAGILERADGSSYLEFGGNKILVAVYGPREAQIRKLQRPDRAVIRCRYNMAPFSV-E 87  Methanothermobacter t...
3L7Z_B  87 ERKNPAPSRREIELSKVIREALESAVLVELFPRTAIDVFTEILQADAGSRLVSLMAASLALADAGIPMRDLIAGVAVGKA 166 Sulfolobus solfataric...
Q8TYC1  86 ERKRPGPDRRSIEISKLSKEALEPAIFTEYYPRTAIDIFVEVLQADAGTRCAGISAASVALADAGIEMRDLVAACAAGKV 165 Methanopyrus kandleri...
O26779  88 ERKRPGPDRRSVEISKITAEALRPALILEKFPRSVIDVFIEVLEAEGGTRCAGITAASVALADAGIPMRDMVVACAAGKV 167 Methanothermobacter t...
Q97BZ5  89 ERKRPGPDRRTMEISKVISEALSSSIMIEQFPRAEIDVYIEVLQADAGTRIAGLTAATVALADAGIPMRDMVVGCTAGKV 168 Thermoplasma volcaniu...
Q9UXC2  90 ERKNPAPSRREIELSKVIREALESAVLVELFPRTAIDVFTEILQADAGSRLVSLMAASLALADAGIPMRDLIAGVAVGKA 169 Sulfolobus solfataric...
Q9YC03  88 ERKSPAPSRREIELSKVVREALEPVVLAEEFPRTVIDVFLEVLQADGGTRTAAVTAASLALADAGIPMRALVGGVAVGKI 167 Aeropyrum pernix K1
Q8ZVM9  86 ERKSPTPSRREIEISKILREALEPAIVLEQYPRSRIDVFVEILQADGSTRVASLTAASLALADAGIYMRDLVVGVSVGLV 165 Pyrobaculum aerophilu...
2WNR_B  88 ERKRPGPDRRSVEISKITAEALRPALILEKFPRSVIDVFIEVLEAEGGTRCAGITAASVALADAGIPMRDMVVACAAGKV 167 Methanothermobacter t...
3L7Z_B 167 DGVIILDLNETEDMWGEADMPIAMMPSLNQVTLFQLNGSMTPDEFRQAFDLAVKGINIIYNLEREALKSKY 237 Sulfolobus solfataricus 98/2
Q8TYC1 166 EGKVVLDPMYYEDGYGEADVPLAMMPKEGKITLLQMDGDMTPGEFKQAVKLAKKGCKIVYKEQRRALKEKY 236 Methanopyrus kandleri AV19
O26779 168 GDQVVLDLSEEEDKEGQADVPVAILPRTREITLLQSDGNLTPEEFERALDLAVEGCLRIHEVQKEALRKRY 238 Methanothermobacter thermautot...
Q97BZ5 169 DGHIVLDLSKEEDNFGEADIPMAIMPKTGEIVLLQMDGDVTEDEFYEATSMIIEATKKISQIQRNALLNKY 239 Thermoplasma volcanium GSS1
Q9UXC2 170 DGVIILDLNETEDMWGEADMPIAMMPSLNQVTLFQLNGSMTPDEFRQAFDLAVKGINIIYNLEREALKSKY 240 Sulfolobus solfataricus P2
Q9YC03 168 QGVLVVDVDELEDMYGEADMPVAAAPDIGEITLLQLNGVLTGEEFRTALAMALRAIDRVVEMEKEAIRKSY 238 Aeropyrum pernix K1
Q8ZVM9 166 DGTVVLDLNGLEDQYGEGDLPLGYMPNLKRFTLLQLDGAWTRDMFLQALNLAVRGAEYVYQIARDALKNKY 236 Pyrobaculum aerophilum str. IM2
2WNR_B 168 GDQVVLDLSEEEDKEGQADVPVAILPRTREITLLQSDGNLTPEEFERALDLAVEGCLRIHEVQKEALRKRY 238 Methanothermobacter thermautot...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap