3C8L


Conserved Protein Domain Family
lin0512_fam

?
TIGR02058: lin0512_fam 
Click on image for an interactive view with Cn3D
conserved hypothetical protein
This family consists of few members, broadly distributed. It occurs so far in several Firmicutes (twice in Oceanobacillus), one Cyanobacterium, one alpha Proteobacterium, and (with a long prefix) in plants. The function is unknown. The alignment includes a perfectly conserved motif GxGxDxHG near the N-terminus. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 131113
View PSSM: TIGR02058
Aligned: 5 rows
Threshold Bit Score: 155.334
Threshold Setting Gi: 499304938
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3C8L_A         5 KRLIIEXGXGIDQHGQEPTIAASRAVRNAIAHNALPGVWE-VAGLSHPNEXIIEVQVAVPYP--EQVREEEVLAVLPFGR 81  Nostoc punctifo...
WP_003721298   3 QILFIQTGFGVDVHGQNITKAAERAVRNAIFTNSMPGIQG-LLPDGDLQNMVVNIKLALPCDa-DQLDEDTIRAIIPYGT 80  Listeria monocy...
WP_011065368   3 KILFIQTGMGIDVHGQNITKAATRAVQNAIWSNSMPGIEN-SLPDNSLENMNVTVRLAVPLDr-DNLDISKIKETIPYGT 80  Oceanobacillus ...
WP_010995713   4 KRLIIEMGMGVDQHGQEPTVAAARAVRNAIAHNALPGVWE-VAGLSHPNEMIVEVQVAVPYP--EKVREEEVLAVLPFGR 80  Nostoc sp. PCC ...
AAM63136      79 KLLFVEMGVGYDQHGQDVTSAAMKACKNAISSNSIPAFRRgSIPGVSFGEMKLQIKLGVPHSlhQQLDLDKVKSIFPYGK 158 thale cress
3C8L_A        82 KT-LTVESGGXIVQ-GRAIPELNDKNDEXLIAIAAVTVL 118 Nostoc punctiforme PCC 73102
WP_003721298  81 VT-IEKMAGGMMTTsGIFLEDKEDKNDLMYIVNASVETG 118 Listeria monocytogenes
WP_011065368  81 VE-VDITDGGMATSsGIILEDKDDENDLMYMVNAAVEVG 118 Oceanobacillus iheyensis
WP_010995713  81 KS-LKVEFGGMVVQ-GRAIPELNDKNDEMLVAIASVTVL 117 Nostoc sp. PCC 7120
AAM63136     159 IVnVEVVDGGLICSsGVLVEEMGDTNEDCYIVNVAVYVG 197 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap