2OQ2,2O8V


Conserved Protein Domain Family
PAPS_reductase

?
TIGR02057: PAPS_reductase 
Click on image for an interactive view with Cn3D
phosphoadenosine phosphosulfate reductase, thioredoxin dependent
Requiring thioredoxin as an electron donor, phosphoadenosine phosphosulfate reductase catalyzes the reduction of 3'-phosphoadenylylsulfate (PAPS) to sulfite and phospho-adenosine-phosphate (PAP). Found in enterobacteria, cyanobacteria, and yeast, PAPS reductase is related to a group of plant (TIGR00424) and bacterial (TIGR02055) enzymes preferring 5'-adenylylsulfate (APS) over PAPS as a substrate for reduction to sulfite. [Central intermediary metabolism, Sulfur metabolism]
Statistics
?
PSSM-Id: 131112
View PSSM: TIGR02057
Aligned: 6 rows
Threshold Bit Score: 354.525
Threshold Setting Gi: 145579980
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2OQ2_A        17 LDHWNEQLIKLeT-PQEIIAWSIVTFPH-LFQTTAFGLTGLVTIDMLSKLSekyYMPELLFIDTLHHFPQTLTLKNEIEK 94  Saccharomyces c...
P72794        10 LPTLQTELENA-T-AQQIITWAAQTFGPgLVMSTSFGIQAAVMLHLVTSIV---PNIPVIWIDTGYLPLETYQFADQLTG 84  Synechocystis s...
P17854        21 LAETNAELEKL-D-AEGRVAWALDNLPGeYVLSSSFGIQAAVSLHLVNQIR---PDIPVILTDTGYLFPETYRFIDELTD 95  Escherichia col...
WP_010998597  16 LDELNQQFETA-T-PKEILAWSIEHIPTgLVQTSAFNVDDLVITHILYSELk--QPVPVIFLDTLFHFQQTLELVAKAKE 91  Nostoc sp. PCC ...
P18408        17 LDHWNEQLIKL-EtPQEIIAWSIVTFPH-LFQTTAFGLTGLVTIDMLSKLSekyYMPELLFIDTLHHFPQTLTLKNEIEK 94  Saccharomyces c...
2O8V_A        21 LAETNAELEKL-D-AEGRVAWALDNLPGeYVLSSSFGIQAAVSLHLVNQIR---PDIPVILTDTGYLFPETYRFIDELTD 95  Escherichia coli
2OQ2_A        95 KYYqpknqtIHVYKPDGCESEADFASKYGDFLWEK--DDDK---YDYLAKVEPAHRAYKELHISAVFTGRRKSQGSARSQ 169 Saccharomyces c...
P72794        85 RLQ------LNLKVYQSPLSPARMEALYGKLWQQK--DVESlnrYDQIRKVEPMQRALKELEAIAWLTGLRRDQTRHRQN 156 Synechocystis s...
P17854        96 KLK------LNLKVYRATESAAWQEARYGKLWEQG---VEGiekYNDINKVEPMNRALKELNAQTWFAGLRREQSGSRAN 166 Escherichia col...
WP_010998597  92 IYNl----dLQTYKTPDVDTREAFTAKYGEALWDK--DITQ---FHHVTKIEPLQRGLDELNTVAWITGRRRDQAVTRAN 162 Nostoc sp. PCC ...
P18408        95 KYYqpknqtIHVYKPDGCESEADFASKYGDFLWEK--DDDK---YDYLAKVEPAHRAYKELHISAVFTGRRKSQGSARSQ 169 Saccharomyces c...
2O8V_A        96 KLK------LNLKVYRATESAAWQEARYGKLWEQGveGIEK---YNDINKVEPMNRALKELNAQTWFAGLRREQSGSRAN 166 Escherichia coli
2OQ2_A       170 LSIIEidELNGILKINPLINWTFEQVKQYIDANNVPYNELLDLGYRSIGDYHSTQPVKEGEDER-AGRWKGkAKTECGIH 248 Saccharomyces c...
P72794       157 LKPVD--LQGNQYKVLPILDWNSKMVYEYLTAHDLPYHPFFDQGYVSVGDWHSSRPLMAHDEDErDTRFHG-LKQECGLH 233 Synechocystis s...
P17854       167 LPVLA--IQRGVFKVLPIIDWDNRTIYQYLQKHGLKYHPLWDEGYLSVGDTHTTRKWEPGMAEE-ETRFFG-LKRECGLH 242 Escherichia col...
WP_010998597 163 MPVFEldGK-GRLKVNPLAAWTRQDSWDYVAEHKVIYNPLHDQGYPSIGDEPITTKVGEGEDER-AGRWRGsNKTECGIH 240 Nostoc sp. PCC ...
P18408       170 LSIIEidELNGILKINPLINWTFEQVKQYIDANNVPYNELLDLGYRSIGDYHSTQPVKEGEDER-AGRWKGkAKTECGIH 248 Saccharomyces c...
2O8V_A       167 LPVLAi--QRGVFKVLPIIDWDNRTIYQYLQKHGLKYHPLWDEGYLSVGDTHTTRKWEPGMAEE-ETRFFG-LKRECglh 242 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap