Conserved Protein Domain Family
ChlG

?
TIGR02056: ChlG 
chlorophyll synthase, ChlG
This model represents the strictly cyanobacterial and plant-specific chlorophyll synthase ChlG. ChlG is the enzyme (esterase) which attaches the side chain moiety onto chlorophyllide a. Both geranylgeranyl and phytyl pyrophosphates are substrates to varying degrees in enzymes from different sources. Thus, ChlG may act as the final or penultimate step in chlorophyll biosynthesis (along with the geranylgeranyl reductase, ChlP). [Biosynthesis of cofactors, prosthetic groups, and carriers, Chlorophyll and bacteriochlorphyll]
Statistics
?
PSSM-Id: 131111
View PSSM: TIGR02056
Aligned: 2 rows
Threshold Bit Score: 584.63
Threshold Setting Gi: 972938
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAB76179  36 QLLGMKGAApGETSIWKIRLQLMKPITWIPLIWGVVCGAASSGNYTWSLENVLKAATCMLLSGPLLTGYTQTLNDFYDRE 115 Nostoc sp. PCC 7120
AAA96740  83 QLLGIKGAS-QETNKWKIRLQLTKPVTWPPLVWGVVCGAAASGNFHWTPEDVAKSILCMMMSGPCLTGYTQTINDWYDRD 161 thale cress
BAB76179 116 IDAINEPYRPIPSGAISVPQVVTQIVLLFIAGIAVAFTLDLWAGHEFPNVTVLALFGSFIAFIYSAPPLKLKQNGWLGNY 195 Nostoc sp. PCC 7120
AAA96740 162 IDAINEPYRPIPSGAISEPEVITQVWVLLLGGLGIAGILDVWAGHTTPTVFYLALGGSLLSYIYSAPPLKLKQNGWVGNF 241 thale cress
BAB76179 196 ALGASYIALPWWAGHALFGELNWKIAVLTLIYSLAGLGIAIVNDFKSVEGDRQLGLQSLPVMFGINTAAWICVVMIDVFQ 275 Nostoc sp. PCC 7120
AAA96740 242 ALGASYISLPWWAGQALFGTLTPDVVVLTLLYSIAGLGIAIVNDFKSVEGDRALGLQSLPVAFGTETAKWICVGAIDITQ 321 thale cress
BAB76179 276 GLIAAYLVTIHENLYAAILVLLIIPQITFQDMYFLRDPLKNDVKYQASAQPFLVLGMLVAGLALGH 341 Nostoc sp. PCC 7120
AAA96740 322 LSVAGYLLASGKPYYALALVALIIPQIVFQFKYFLKDPVKYDVKYQASAQPFLVLGIFVTALASQH 387 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap