Conserved Protein Domain Family
MerD

?
TIGR02054: MerD 
mercuric resistence transcriptional repressor protein MerD
This model represents a transcriptional repressor protein of the MerR family (pfam00376) whose expression is regulated by the mercury-sensitive transcriptional activator, MerR. MerD has been shown to repress the transcription of the mer operon. [Cellular processes, Detoxification]
Statistics
?
PSSM-Id: 131109
View PSSM: TIGR02054
Aligned: 3 rows
Threshold Bit Score: 176.609
Threshold Setting Gi: 18076030
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P08654     1 MNAYTVSRLALDAGVSVHIVRDYLLRGLLRPVACTTGGYGLFDDAALQRLCFVRAAFEAGIGLGALARLCRALDAANCDE 80  Serratia marcescens
CAC80081   2 MNAYTISRLAEDAGVSVHVGRDYVLRGLLHPARRTESGYGIFDERSLARLRFVRAAFESGIGLDELARLCRALDADDGAD 81  Pseudomonas sp.
CAB65707   1 MSSYKISKLAEQAGVSVHVVRDYLLRGLLHPVRRTDSGYGIFDAQSLNRLRFVRTAFEAGIDLRELARWCQSLDGGGG-D 79  Xanthomonas campestris
P08654    81 TAAQLAVLRQFVERRREALANLEVQLAAMPTAPAQHAESL 120 Serratia marcescens
CAC80081  82 LIGCVECLLRLVTARQAALAAVATQLAGLTHCAGEGSAYA 121 Pseudomonas sp.
CAB65707  80 IDECRAHLRSLIAARRETLVALDRQLAAGLPHAEPESRHA 119 Xanthomonas campestris
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap