Conserved Protein Domain Family
MerP

?
TIGR02052: MerP 
mercuric transport protein periplasmic component
This model represents the periplasmic mercury (II) binding protein of the bacterial mercury detoxification system which passes mercuric ion to the MerT transporter for subsequent reduction to Hg(0) by the mercuric reductase MerA. MerP contains a distinctive GMTCXXC motif associated with metal binding. MerP is related to a larger family of metal binding proteins (pfam00403). [Cellular processes, Detoxification]
Statistics
?
PSSM-Id: 131107
View PSSM: TIGR02052
Aligned: 3 rows
Threshold Bit Score: 115.519
Threshold Setting Gi: 2052180
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAC69250  1 MKKIAtLLALSAALSAPAWAVTQTVTLSIPGMTCGACPITVRTALKRVPGVEKVGIDEAQKLVTVTYDDSKTNVQALTQA 80  Acidithiobacillus fe...
AAM08084  1 MKTLA-LMSLFVLTSLNALAAPKTVTLEVPTMNCVTCPFTVEKALQKVDGVSKAEVTFKTKLAVVTFDDEKTTVKALTEA 79  Providencia rettgeri
CAA67449  1 MRKLLaSLALASLVATPVWAATQTVTLAVPGMTCAACPITVKTALTKVDGVTKAEVSFENREAIVTFDDTKTNALALTKA 80  Pseudomonas sp.
CAC69250 81 TKDAGYPSSIKQ 92  Acidithiobacillus ferrooxidans
AAM08084 80 TTNAGYPSTLKE 91  Providencia rettgeri
CAA67449 81 TEDAGYPSSVKQ 92  Pseudomonas sp.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap