Conserved Protein Domain Family
MerR

?
TIGR02051: MerR 
Hg(II)-responsive transcriptional regulator
This model represents the mercury (II) responsive transcriptional activator of the mer organomercurial resistance operon. This protein is a member of the MerR family of transcriptional activators (pfam00376) and contains a distinctive pattern of cysteine residues in its metal binding loop, Cys-X(8)-Cys-Pro, as well as a conserved and critical cysteine at the N-terminal end of the dimerization helix. [Cellular processes, Detoxification, Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 131106
View PSSM: TIGR02051
Aligned: 8 rows
Threshold Bit Score: 198.374
Threshold Setting Gi: 11496141
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P22853         4 RIGELADKCGVNKETIRYYERLGLIPEPERTEKGYRMYSQQTVDRLHFIKRMQELGFTLNEIDKLLGVVDRdeAKCRDMY 83  Bacillus cereus
CAC80887       9 TIGVFAKAVGVNVETIRFYQRKGLLPEPDKPYGSIRRYGEADVTRVRFVKSAQRLGFSLDEIAELLRLEDG--THCEEAS 86  Acinetobacter s...
CAA40597       5 TIGALAASAGVHVETVRFYQRKGLLPEPDRLPGSIRRYGQSDLERLHFVKSAKGLGFSLEEIGQLLKLADG--THCREAA 82  Acidithiobacill...
AAD40337       6 TIGKLADAAGVNVETIRYYQRRGLLDEPAKPLGGHRRYPVDMVKRLRFIKRAQALGFTLSEVGGLLTLDES--CACAETR 83  Pseudomonas alc...
CAC14712       3 TISQLAKSAGVNVETVRYYERRGRIEQPDKPTEGYRRYPVTTLNRIRFIKRAQELGFTLEEISHLMMLDN---TPCQEVQ 79  Pseudomonas sp....
AAF99441      25 TISMLAKELSVNVETIRFYERKGLIKQPPKPMQGYRHYPKETVNRIHFIKRSQELGFTLNEIEGLLALND---SPCSKVQ 101 Pseudoalteromon...
P22874         4 KISELAKACDVNKETVRYYERKGLIAGPPRNESGYRIYSEETADRVRFIKRMKELDFSLKEIHLLFGVVDQdgERCKDMY 83  Staphylococcus ...
WP_000640387   4 RISEFADKCGVNKETIRYYERKNLLQEPHRTEAGYRIYSYDDVKRVGFIKRIQELGFSLSEIYKLLGVVDKdeVRCQDMF 83  Streptococcus
P22853        84 DFTILKIEDIQRKIEDLKRIERMLMDLKERCPENKDIYECPIIETL 129 Bacillus cereus
CAC80887      87 GLAEHKLKDVREKMADLARMEAVLSELMCACHARKGNVSCPLIASL 132 Acinetobacter sp. ED23-35
CAA40597      83 ELASRHLASVQARLRELHRIEYALQKQLEACKSQQGNFSCPLIDSL 128 Acidithiobacillus ferrooxidans
AAD40337      84 ARAARKLALIEQKMADLVVMQQLLGELVQQCDAGDGGTICPIIEAL 129 Pseudomonas alcaligenes
CAC14712      80 DMASHKLVSVRAKMADLRRLETVLNDLLNQCAANPDQTHCPIIDSL 125 Pseudomonas sp. BW13
AAF99441     102 ELANKKLIAVQKKMADLLLLEHALEEHLGQCQNNDDDSHCPIIDSL 147 Pseudoalteromonas haloplanktis
P22874        84 AFTVQKTKEIERKVQGLLRIQRLLEELKEKCPDEKAMYTCPIIETL 129 Staphylococcus aureus
WP_000640387  84 EFVSKKQKEVQKQIEDLKRIETMLDDLKQRCPDEKKLHSCPIIETL 129 Streptococcus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap