Conserved Protein Domain Family
gshA_cyano

?
TIGR02048: gshA_cyano 
glutamate--cysteine ligase, cyanobacterial, putative
This family consists of proteins believed (see Copley SD, Dhillon JK, 2002) to be the glutamate--cysteine ligases of several cyanobacteria, which are known to make glutathione. [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs]
Statistics
?
PSSM-Id: 131103
View PSSM: TIGR02048
Aligned: 3 rows
Threshold Bit Score: 740.215
Threshold Setting Gi: 499368599
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010873241   3 LTKGLEVEIYTGKKTGEIVGLSDRIVRDLSGFVREPDSRNVEYTTPPLNSYDRLLCGILQPRRQLRHYLSQLGeDYTLIP 82  Synechocystis s...
WP_010997502   3 LLKGFEIEMYTGTPQGEIVGLSDKIVTQLDGFVREPDSRNVEYTTDPLHSYENLLCALLRPRRALRDYLKQLG-DYTLIP 81  Nostoc sp. PCC ...
WP_011056177   2 LSKGFEVELYTGKPTGEIVGLSDRIVKDLPGFVREPDSRNVEFTTPPVYLYDQALCDLLRPRFRLRAYLQSLG-DLTLVP 80  Thermosynechoco...
WP_010873241  83 GSCLALGGTDTFYRSDPQNPYHTYIEQTYSTQVVTASIHINIGIPDVEELIRACRLVRMEAPLYLALSASSPFLNGQVTG 162 Synechocystis s...
WP_010997502  82 GSTLSLGRSDRFFRSDPANPYHDYIEQTYGTKVVTASVHINVGIDDPEVLMRACRLIRVEAPLFLALSASSPFIDGKATG 161 Nostoc sp. PCC ...
WP_011056177  81 GSTLSLGDTQRFYRSDPQNPYHTYIEQTYGTRVVTASVHINIGLREPEALMRACRLVRLEAPLFLALSAASPFLDGQVTG 160 Thermosynechoco...
WP_010873241 163 YHSSRWQMFPKTPQEVPLFTSHGHFVQWTEEQLTLGTMQNVRHLWSAVRPNGDNRPHNLNRLELRICDLVTNPLSLLAIV 242 Synechocystis s...
WP_010997502 162 YHSTRWGVFPQTPTNVPLFTSHAHHIEWVEQQLAIGTMQNVRHLWVSVRPNGDRRPYDLNRLELRICDLVTDPISLLAIT 241 Nostoc sp. PCC ...
WP_011056177 161 YHSTRWAIFPKTPPQVPLFTSHAHFIEWTEAQLQQGTMQNVRHLWSAVRPNGDRRPYDLNRLELRICDLVTDPIALLAIT 240 Thermosynechoco...
WP_010873241 243 ALLEARLQQMLADPTLDPLQQSQLTPSELLALADQNEISAAVSSLDSTLHHWRDGRAIAAREWIEELYQSVQLEAKYQGF 322 Synechocystis s...
WP_010997502 242 ALLEARLLQLIENPDLDPLTQSKFSPEELVTLTAKNEAAAASASLDAQLTHWQDGRSIIARDWVNEIYQEVWAIAKKHGF 321 Nostoc sp. PCC ...
WP_011056177 241 ALLEARLLQLLDTPDLDPLRWG--DRETLAQLADENEQLAAKRSLEAVLTHWRDRRQLTAAAWIAELYEEVWPIAKAQGF 318 Thermosynechoco...
WP_010873241 323 ACFLPPLRKILREGNQAQQWLTQYEQGKTPQTIVQEAILQTEMEEAILAQDLCLPLS 379 Synechocystis sp. PCC 6803
WP_010997502 322 SCFLSPLQKILREGNEAQHWLQLHKVGFDTQCVITQAISTTQERELELQNKLCTQLK 378 Nostoc sp. PCC 7120
WP_011056177 319 SCFLVPIKKILRQGNTAQQWLAQYAAGQTIPEIMAQAVQEMAANEQEFADQLCPPLA 375 Thermosynechococcus elongatus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap