Conserved Protein Domain Family
CadR-PbrR

?
TIGR02047: CadR-PbrR 
Cd(II)/Pb(II)-responsive transcriptional regulator
This model represents the cadmium(II) and/or lead(II) responsive transcriptional activator of the proteobacterial metal efflux system. This protein is a member of the MerR family of transcriptional activators (pfam00376) and contains a distinctive pattern of cysteine residues in its metal binding loop, Cys-X(6-9)-Cys, as well as a conserved and critical cysteine at the N-terminal end of the dimerization helix. [Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 131102
View PSSM: TIGR02047
Aligned: 4 rows
Threshold Bit Score: 210.043
Threshold Setting Gi: 13898625
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAC86842       1 MRIGQLAQLVGVETQTIRFYEQQGLLPPPDRQDNGYRVYTEKHVERLAFIRRCRILDLSLAEIHELKRYQDDPHQPCTAV 80  Pseudomonas putida
AAK48830       1 MKIGELAKATDCAVETIRYYEREQLLPEPARSDGNYRLYTQAHVERLTFIRNCRTLDMTLDEIRSLLRLRDSPDDSCGSV 80  Pseudomonas putida
CAC80780       3 LKIGELSKKTSCSVLTIRFYEKEGLIPEPERTEGNYRLYDVGYVERIKFILNCRTLNMSLNEIRQLLTYKDKPEKNCSDV 82  Acinetobacter s...
WP_016724358   1 MKIGELAQRTGVSIETIRFYEAQGLLPPPARAANNYRVYTPEHAEQLAFIAKCRSLDMAHAEIRRLMELQANPQASCKEI 80  Ralstonia solan...
CAC86842      81 NALLDDHISHVRSQITALQALEKQLVSLRASCNDDReVEaCGVLAGI 127 Pseudomonas putida
AAK48830      81 NALIDEHIEHVQARIDGLVALQEQLVELRRRCNAQG-AE-CAILQQL 125 Pseudomonas putida
CAC80780      83 NELIDLHVSAIRENIIKQQKLIEQLSDLRGTCDGLCtIDqCGVLKNL 129 Acinetobacter sp. BW3
WP_016724358  81 NRLLDEHLRHVEARIAELTELKRQIEAIGQRCTTAAsVAeCGVLQSL 127 Ralstonia solanacearum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap