Conserved Protein Domain Family
sdhC_b558_fam

?
TIGR02046: sdhC_b558_fam 
succinate dehydrogenase (or fumarate reductase) cytochrome b subunit, b558 family
This family consists of the succinate dehydrogenase subunit C of Bacillus subtilis, designated cytochrome b-558, and related sequences that include a fumarate reductase subunit C. This subfamily is only weakly similar to the main group of succinate dehydrogenase cytochrome b subunits described by pfam01127, so that some members score above the gathering threshold and some do not. [Energy metabolism, TCA cycle]
Statistics
?
PSSM-Id: 131101
View PSSM: TIGR02046
Aligned: 5 rows
Threshold Bit Score: 210.796
Threshold Setting Gi: 118620
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P08064         5 REFYFRRLHSLLGVIPVgIFLIQHLVVNQFAAR--GAEAFNSAAHFMDSLPF-------RYALEIFIIFLPLIYHAVYGV 75  Bacillus subtil...
WP_000345920  10 SSIGRKTLVAATGLVYF-GFVVVHMLGNLQIFL--GQEKINAYGQSLRDIAP-------LLWVARIILIVSFIIHVYYAI 79  Leptospira inte...
WP_004584031   6 SSIGRKVVMSVTGLALI-LFLTFHMSMNLVALF--SAEAYNMICEFLGANWY-------ALVAS-IGLAVLMLLHIVYAF 74  Porphyromonas g...
WP_010933917  28 SSITSKVVMALAGLFLL-VFLAVHLGINMLLLVddGGKSFSAAAGFMSSYPV--------IRVFELALFGGFALHIAFGV 98  Chlorobaculum t...
WP_011027449  28 STVGKKTVMAVSGLVML-LYLVAHMIGNLKIYF--GVEEFNHYAHWLRTVGEpfmhyewTLWLIRVVLVVAVVAHAVSAY 104 Streptomyces co...
P08064        76 YIAFTAKNnAGQYSYMRN-------WLFVLQRVTGIITLIFVSWHVWETRIAAQMG-----AEV--N------------F 129 Bacillus subtil...
WP_000345920  80 KLTIENRQ-ARPVPYSKKntv-qatLASRTMALTGLLIFSFIVYHLLHFTLGVTNPdhfamTDAkgRhd---------iY 148 Leptospira inte...
WP_004584031  75 ILNAQNLRaRGRDRYAVTgrpkgveWSSQNMLVLGIIVLLGIGLHMFNFWAKMQLAeichmDVA--GfgidgfdhpakgA 152 Porphyromonas g...
WP_010933917  99 IVSIRN-RmSRPIRYQHRsrs-etsPFSKYMLHSGIVVLIFLGLHFIDFYFIKLGIvapppGVA--Rhd---------fY 165 Chlorobaculum t...
WP_011027449 105 QLSRRDIK-ARPSKYVHKkar--ssYATRTMRWGGIILGLFIVWHILDLTTGTVHSggfetGKP---------------Y 166 Streptomyces co...
P08064       130 DMMANILSSPAMLGFYIVGVLSTIFHFSNGLWSFAVTWGITVTPRSQRIST---YVTLIIFVALSYVGLKAIFAFV 202 Bacillus subtilis s...
WP_000345920 149 TMVVLGFQNPIVASSYIFAMLLLATHISHGVASVFQTLGLNTPYFSGKIKAgaiLFALLIFIGNTSIPLSILLGYV 224 Leptospira interrogans
WP_004584031 153 ELIRYTFNQPIYVVLYAVWLIALWFHLTHGFWSALQTLGWNNTIWMNRVKCisnVVSTVLVGGFALVLIVFACQAF 228 Porphyromonas gingi...
WP_010933917 166 SRAVLLFSDRTSSSIYMVAFVFLGFHLNHALQAAIQTLGLNHTRHAAAIQAvstVYAIVIAGGFMAIPLRFTLFN- 240 Chlorobaculum tepidum
WP_011027449 167 QNVVDTFSTWYGNVIYIVAMLALGLHIQHGFWSAAQTLGAGSRTRDRALKTtanVLALLLTIGFIAVPVGVMTGVV 242 Streptomyces coelic...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap