Conserved Protein Domain Family
P_fruct_ADP

?
TIGR02045: P_fruct_ADP 
ADP-specific phosphofructokinase
Phosphofructokinase is a key enzyme of glycolysis. The phosphate group donor for different subtypes of phosphofructokinase can be ATP, ADP, or pyrophosphate. This family consists of ADP-dependent phosphofructokinases. Members are more similar to ADP-dependent glucokinases (excluded from this family) than to other phosphofructokinases. [Energy metabolism, Glycolysis/gluconeogenesis]
Statistics
?
PSSM-Id: 131100
View PSSM: TIGR02045
Aligned: 4 rows
Threshold Bit Score: 714.283
Threshold Setting Gi: 21362623
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9HH12  13 SIYTAYNTNVDAIVYLNGETVQRLIDEFGADAVRKRMEDYPREINEPLDFVARLVHALKTGKPMAVPLVN-EELHTWFDS 91  Thermococcus zilligii
P58847  26 GMFVAYNSNIDAIRHLTEEDLSKLVGFFDESDIQDRVAAYPREIAEPLDFVARLLISMREGKAAEVPAYT-ADIHEWLKE 104 Methanosarcina acetiv...
Q9V2Z7   9 GIYTAYNANVDAIVNLNAEIIQRLIEEFGPDKIKRRLEEYPREINEPLDFVARLVHALKTGKPMAVPLVN-EELHQWFDK 87  Pyrococcus furiosus D...
Q58999  18 KLFTAYNTNVDAIKYLKDEDVQKLVDEFNHKDIIERMEEYPRIIEEPLDFVARLVHSIKTGKPAEVPIKDdKKLHEWFDR 97  Methanocaldococcus ja...
Q9HH12  92 HFRYDVERMGGQAGIIANLLSNLDFREVIVYTPHLAKRQAEMFVRKPNLFYPVVEGGRLVLKHPWEAYREGDPVKVNRIF 171 Thermococcus zilligii
P58847 105 HLGFDYARMGGQAGIISNLLGRLGLKKVVAYVPWLSEEQAEYFTATGNILHPKVENGKVLLKPPGEAFKPGIGSKVNWIL 184 Methanosarcina acetiv...
Q9V2Z7  88 TFKYDTERIGGQAGIIANILVGLKVKKVIAYTPFLPKRLAELFKEG--ILYPVVEEDKLVLKPIQSAYREGDPLKVNRIF 165 Pyrococcus furiosus D...
Q58999  98 -IKYDEERMGGQAGIVSNLMATLQIDKIIVYTPFLSKKQAEMFVDYDNLLYPLVENGNLVLKKVREAYRD-DPIKINRIF 175 Methanocaldococcus ja...
Q9HH12 172 EFRAGTAFKLGDERIVVPFSGRFIVSARFES-IRIYTEPGLRPFLPEIgERVDGAILSGYQGINLRYSDGKDANYYLRKA 250 Thermococcus zilligii
P58847 185 EYSKDMNVTCAGNTFKVPRDNRLIISSRPKW-LRLDMDKQIYEQLDTL-LPVDGAMLSGYQMIKEEYEDGSTYKDYVENS 262 Methanosarcina acetiv...
Q9V2Z7 166 EFRKGTRFKLGDEVIEVPHSGRFIVSSRFESiSRIETKDELRKFLPEIgEMVDGAILSGYQGIRLQYSDGKDANYYLRRA 245 Pyrococcus furiosus D...
Q58999 176 EFKKGLKFKLNGEEITAKQSTRFIVASRPEA-LRIEIKDDVRKFLPKIgEAVDCAFLSGYQAIKEEYRDGKTAKYYFERA 254 Methanocaldococcus ja...
Q9HH12 251 KEDIMLLKRE-KDLKVHLEFASIQSRELRKKVIYNLFP-LADSVGMDEAEIAYVLSALGYDELADRIFT--YNRIEDTVL 326 Thermococcus zilligii
P58847 263 VKVIEKLKSLnPELRIHVELTSIQNRLIRKAILTEIVArHVHSLGLDTVEVANALNVLGHEELSYSVIRkgENGIMSLYQ 342 Methanosarcina acetiv...
Q9V2Z7 246 KEDIRLLKKN-KDIKIHVEFASIQDRRLRKKVVNNIFP-MVDSVGMDEAEIAYILSVLGYSDLADRIFM--YNRIEDAIL 321 Pyrococcus furiosus D...
Q58999 255 EEDIKLLKKN-KNIKTHLEFASISNIEIRKMVVDYILS-NVESVGMDETEIANVLHILGYDELSNNILK--DSFIEDVIE 330 Methanocaldococcus ja...
Q9HH12 327 GGKILLDEMN-LDVLQIHTIYYIMYITHADNPLSEEELRRSLELATTLAASRASLGDITSPDQIEIGLRVPYNER--GEY 403 Thermococcus zilligii
P58847 343 GAVQLMKDLD-LERVHVHSLGFYICILAKGHPLTLKEHRDSLLFSSVLAAAQALNGNIENLAEAEAGLEVPVSSIglEDL 421 Methanosarcina acetiv...
Q9V2Z7 322 GGMIILDELN-FEILQVHTIYYLMYITHRDNPLSEEELMRSLDFGTILAATRASLGDINDPRDVKVGMSVPYNER--SEY 398 Pyrococcus furiosus D...
Q58999 331 GAKILLDKFKnLEVVQVHTIYYILFVCRADNPLSKEELEECLEFSTILASTKAKLGNIRAIDDLHEGLKIPHNKY--GDL 408 Methanocaldococcus ja...
Q9HH12 404 VKLRFEEAKRKLRT-----------KEYKLVIIPTRLVQNPVSTVGLGDTISTGAFASYLAMLKEK 458 Thermococcus zilligii
P58847 422 ENFQLYCTGRKLCTpdefeygyvygSEHDAILIPSKVVERPKATVGIGDTISAGAFVAMLAKIKQK 487 Methanosarcina acetivorans C2A
Q9V2Z7 399 IKLRFEEAKRKLRL-----------KEYKVVIVPTRLVPNPVSTVGLGDTISTGTFLSYLSLLRRH 453 Pyrococcus furiosus DSM 3638
Q58999 409 LK----EIAEKFND-----------NNYKIALSPSRYVEKPKSTVGLGDTISSGAFVYYVSLLNKK 459 Methanocaldococcus jannaschii DSM 2661
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap