1Q05


Conserved Protein Domain Family
CueR

?
TIGR02044: CueR 
Click on image for an interactive view with Cn3D
Cu(I)-responsive transcriptional regulator
This model represents the copper-, silver- and gold- (I) responsive transcriptional activator of the gamma proteobacterial copper efflux system. This protein is a member of the MerR family of transcriptional activators (pfam00376) and contains a distinctive pattern of cysteine residues in its metal binding loop, Cys-X7-Cys. This family also lacks a conserved cysteine at the N-terminal end of the dimerization helix which is required for the binding of divalent metals such as zinc; here it is replaced by a serine residue. [Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 131099
View PSSM: TIGR02044
Aligned: 6 rows
Threshold Bit Score: 220.011
Threshold Setting Gi: 499312455
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1Q05_A         1 MNISDVAKITGLTSKAIRFYEEKGLVTPPMRSENGYRTYTQQHLNELTLLRQARQVGFNLEESGELVNLFNDPQRHSADV 80  Shigella flexneri
Q8Z8S3         1 MNISDVAKKTGLTSKAIRFYEEKGLVTPPLRSENGYRTYTQKHLNELTLLRQARQVGFNLEECGELVNLFNDPRRHSADV 80  Salmonella ente...
BAC62004       1 MNIGAVAKLTGLSSKSIRLYEDKGIISPPARSDSGYREYSDNHIQELNLVSRAKNAGFSLQECKEFVQLAHNPNRKSSEV 80  Vibrio parahaem...
AAB70271       1 MNIGQAAKNPVFSSKMIRYYEQIGLIPKAIRTDGGYRDYNDSDVDCFRFISHSRALGFSTEQISTLLVLWNNRERTSADV 80  Proteus mirabilis
WP_011003230  15 VNIGEAARASGVSAKMIRYYERIGLLPPSPRTEGNYRVYDPRALHVLRFIHRARSLGFSLEEIRTLLSLWHDRARASADV 94  Ralstonia solan...
Q9KTC8         1 MNISQIAKLTSLTAKSIRLYEEKGLIIPPLRSESGYRTYTQQHVDDLLLIARCRRVGFSLDECKAMLTLANDPNRTSAAV 80  Vibrio cholerae
1Q05_A        81 KRRTLEKVAEIERHIEELQSMRDQLLALANACPGDDSADCPIIENLS 127 Shigella flexneri
Q8Z8S3        81 KKRTLEKVAEIERHISELQSMRDQLLAMAESCPGDDSADCPIIDNLS 127 Salmonella enterica subsp. enterica serovar Typhi
BAC62004      81 KERTMDKLREVEEKIAHLMEIKKQLEGWVSACPGDAKSRCPIIDELT 127 Vibrio parahaemolyticus RIMD 2210633
AAB70271      81 KAIALSHIDELNRKITQLQRMTQTLSHLAQECQGDNNPDCPIIAKLV 127 Proteus mirabilis
WP_011003230  95 KAITLRHVADLDARIRELQGMRDTLVTLADACHGDDRPDCPILEGVA 141 Ralstonia solanacearum
Q9KTC8        81 RARAQEKWQEISRKLSELTMIKQQLEEWIASCPGDQGSDCPIIEQLK 127 Vibrio cholerae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap