Conserved Protein Domain Family
ZntR

?
TIGR02043: ZntR 
Zn(II)-responsive transcriptional regulator
This model represents the zinc and cadmium (II) responsive transcriptional activator of the gamma proteobacterial zinc efflux system. This protein is a member of the MerR family of transcriptional activators (pfam00376) and contains a distinctive pattern of cysteine residues in its metal binding loop, Cys-Cys-X(8-9)-Cys, as well as a conserved and critical cysteine at the N-terminal end of the dimerization helix. [Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 131098
View PSSM: TIGR02043
Aligned: 3 rows
Threshold Bit Score: 217.807
Threshold Setting Gi: 28807920
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAC61157       1 MFQIGELAKRCGVTSDTLRFYEKNALIKPAGRSESGYRLYNEENQKQVRFILKAKELGLSLDEIKDLLEIKLEATEHSCA 80  Vibrio parahaem...
WP_002209015   4 MLKIGQLAKLADVTPDTIRYYEKQGMMDHGERTDGGYRLYTDQDLQRLRFIRYAKQLGFTLDTIAELLSIRIDPDHHTCQ 83  Yersinia pestis
WP_011070799   1 MYRIGELADLCEVKADTLRFYEKHGLLAPSSRTDSGYRVYTDADAARLRFILRAKAVGFTLSEISELLSIDLDKSNWACA 80  Shewanella onei...
BAC61157      81 EVKAITSAKLELIDEKINELTKIRRALKKINDACCGHTNDdASHCSILAALE 132 Vibrio parahaemolyticus RIMD 2210633
WP_002209015  84 ESKSIVDSRLSDVEGKIRELERMRDSLKRLSEACCGTSHA-TTYCSILEALE 134 Yersinia pestis
WP_011070799  81 DVKGMVDLKLAQVQAKIAELLHFQTSLQSLSNACCGGPRS-AEHCSILEALE 131 Shewanella oneidensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap