Conserved Protein Domain Family
sir

?
TIGR02042: sir 
ferredoxin-sulfite reductase
Distantly related to the iron-sulfur hemoprotein of sulfite reductase (NADPH) found in Proteobacteria and Eubacteria, sulfite reductase (ferredoxin) is a cyanobacterial and plant monomeric enzyme that also catalyzes the reduction of sulfite to sulfide. [Central intermediary metabolism, Sulfur metabolism]
Statistics
?
PSSM-Id: 131097
View PSSM: TIGR02042
Aligned: 4 rows
Threshold Bit Score: 1107.99
Threshold Setting Gi: 93141312
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P30008         5 AAP----QKLSKVEDLKARSQYLLEPILSQLQEESTHFNEDGIQILKFHGSYQQDNRDNRVkgqEKDFQFMLRLRSPGGY 80  Synechococcus e...
BAA33531      64 AKPaavePKRSKVEIFKEQSNFIRYPLNEEILNDAPNINEAATQLIKFHGSYMQYDRDERG---GRSYSFMLRTKNPGGE 140 common tobacco
CAA89154      66 AKPet-atKRSKVEIIKEKSNFIRYPLNEELLTEAPNVNESAVQLIKFHGSYQQYNREERG---GRSYSFMLRTKNPSGK 141 thale cress
WP_010995520   5 APPpttgRKPSKVEGLKENSNFLREPVATQILEDTTHFTEDAVQILKFHGSYQQDNRDNRTkgqEKDYQFMLRTKNPGGL 84  Nostoc sp. PCC ...
P30008        81 IPPQLYLTLDQLADDYGNGTLRATTRQAFQLHGILKRDLKTVIRRIVENLGSTISACGDVNRNVMAPPAPFRDRpEYEWA 160 Synechococcus e...
BAA33531     141 VPNRLYLVMDDLADQFGIGTLRLTTRQTFQLHGVLKKNLKTVMSTIIKNMGSTLGACGDLNRNVLAPAAPFAKK-DYMFA 219 common tobacco
CAA89154     142 VPNQLYLTMDDLADEFGIGTLRLTTRQTFQLHGVLKQNLKTVMSSIIKNMGSTLGACGDLNRNVLAPAAPYVKK-DYLFA 220 thale cress
WP_010995520  85 VPPQLYLALDKLADEYGNHTLRATTRQGFQMHGILKKNLKAAIATIVRNLGSTLGACGDINRNVMAPPAPFKNRaEYQYA 164 Nostoc sp. PCC ...
P30008       161 RTYANNIADLLTPESGAYYELWLDGEKVLSGEPdPAVLAARR-NPKG-RVADSVEPLYSDRYLPRKFKIAVTVPGDNSID 238 Synechococcus e...
BAA33531     220 KQTADNIAALLTPQSGFYYDVWVDGEKVMTAEP-PEVVKARNdNSHGtNFPDSPEPIYGTQFLPRKFKIAVTVPTDNSVD 298 common tobacco
CAA89154     221 QETADNIAALLSPQSGFYYDMWVDGEQFMTAEP-PEVVKARNdNSHGtNFVDSPEPIYGTQFLPRKFKVAVTVPTDNSVD 299 thale cress
WP_010995520 165 WEYAQNIADLLSPQTGAYYEIWLDGEKAISAEEsPEVKAARQsNGNGtIIHDTEEPLYGTYYMPRKFKVSVTVPGDNSID 244 Nostoc sp. PCC ...
P30008       239 LFTQDIGLVVIGNDRGELEGFNVYVGGGMGRTHNKEETFARLADPLGFVPAADIYAAVQAIVATQRDYGDRSNRRHARMK 318 Synechococcus e...
BAA33531     299 IFTNDIGVVVVSNEDGEPQGFNIYVGGGMGRTHRMETTFPRLAEPLGYVPKEDILYAVKAIVVTQRENGRRDDRRYSRLK 378 common tobacco
CAA89154     300 LLTNDIGVVVVSDENGEPQGFNIYVGGGMGRTHRMESTFARLAEPIGYVPKEDILYAVKAIVVTQREHGRRDDRKYSRMK 379 thale cress
WP_010995520 245 LYSQDLTLVVLTDKKGNLEGFNIFAGGGLGRTHNKEETFARLADPIGYVAKEDVYSAVKAIVATQRDYGDRTDRRHARLK 324 Nostoc sp. PCC ...
P30008       319 YLIHDWGIAKFKEAVESVFGKAIAPVRELPPFRYRDYLGWHEQGDGKWFLGLPITSGRIKDdgnwQLRSALREIVSRWQL 398 Synechococcus e...
BAA33531     379 YLLSSWGIEKFRSVTEQYYGKKFQPCRELPEWEFKSYLGWHEAGDGSLFCGLHVDNGRVKG----AMKKALREVIEKYNL 454 common tobacco
CAA89154     380 YLISSWGIEKFRDVVEQYYGKKFEPSRELPEWEFKSYLGWHEQGDGTWFCGLHVDSGRVGG----IMKKTLREVIEKYKI 455 thale cress
WP_010995520 325 YLINDWGVDKFRAKVEEYFGKPIAPFKQLPEFKYHDFLGWHEQGDGNLFLGISIDNGRVKDegafQLKTALREIVEQFNL 404 Nostoc sp. PCC ...
P30008       399 PLLLTGSQDVLIYDVQPGDRAAIDKLLRDR-GVHTVEAIDSLQRYAMACPALPTCGLAITESERALPGLLVRIRRLLEEQ 477 Synechococcus e...
BAA33531     455 NVRLTPNQNIILCNIRQAWKRPITTVLAQG-GLLQPRYVDPLNLTAMACPAFPLCPLAITEAERGIPDILKRVRAIFERV 533 common tobacco
CAA89154     456 DVRITPNQNIVLCDIKTEWKRPITTVLAQA-GLLQPEFVDPLNQTAMACPAFPLCPLAITEAERGIPSILKRVRAMFEKV 534 thale cress
WP_010995520 405 PIRLTPNQNLIFYEITPENKPAIQAILDRCnVVSDPTTIEPLVRYAMACPALPTCGLAITESERAIPGILERIRTLLDKL 484 Nostoc sp. PCC ...
P30008       478 GLP-DEHFVVRMTGCPNGCARPYMAELAFVGSAPNTYQLWLGGSPDQTRLARPFIDRLADGDVETQLRPLFVFFKQSRQA 556 Synechococcus e...
BAA33531     534 GLKySESVVIRITGCPNGCARPYMAELGLVGDGPNSYQIWLGGTPNQTSLAKTFKDKLKVQDLEKVLEPLFFHWRRKRQS 613 common tobacco
CAA89154     535 GLDyDESVVIRVTGCPNGCARPYMAELGLVGDGPNSYQVWLGGTPNLTQIARSFMDKVKVHDLEKVCEPLFYHWKLERQT 614 thale cress
WP_010995520 485 GLQ-NEHFVVRMTGCPNGCARPYMAELGFVGSAPESYQVWLGGSPNQTRLAQPYVEKLHDNDIESFLEPIFVYFRKYRKS 563 Nostoc sp. PCC ...
P30008       557 GESFGDFCDRVGFDALRQFSESY 579 Synechococcus elongatus PCC 7942
BAA33531     614 KESFGDFTNRMGFEKLGEFVEKW 636 common tobacco
CAA89154     615 KESFGEYTTRMGFEKLKELIDTY 637 thale cress
WP_010995520 564 GESFGDFCDRVGFDAIREFVAEY 586 Nostoc sp. PCC 7120
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap