Conserved Protein Domain Family
CysD

?
TIGR02039: CysD 
sulfate adenylyltransferase, small subunit
Metabolic assimilation of sulfur from inorganic sulfate, requires sulfate activation by coupling to a nucleoside, for the production of high-energy nucleoside phosphosulfates. This pathway appears to be similar in all prokaryotic organisms. Activation is first achieved through sulfation of sulfate with ATP by sulfate adenylyltransferase (ATP sulfurylase) to produce 5'-phosphosulfate (APS), coupled by GTP hydrolysis. Subsequently, APS is phosphorylated by an APS kinase to produce 3'-phosphoadenosine-5'-phosphosulfate (PAPS). In Escherichia coli, ATP sulfurylase is a heterodimer composed of two subunits encoded by cysD and cysN, with APS kinase encoded by cysC. These genes are located in a unidirectionally transcribed gene cluster, and have been shown to be required for the synthesis of sulfur-containing amino acids. Homologous to this E.coli activation pathway are nodPQH gene products found among members of the Rhizobiaceae family. These gene products have been shown to exhibit ATP sulfurase and APS kinase activity, yet are involved in Nod factor sulfation, and sulfation of other macromolecules. [Central intermediary metabolism, Sulfur metabolism]
Statistics
?
PSSM-Id: 131094
View PSSM: TIGR02039
Aligned: 7 rows
Threshold Bit Score: 515.825
Threshold Setting Gi: 18275929
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P57499         9 LRQLESESIYIMREVMSDFQNPVMLYSIGKDSSVMLHLAKKSFYPGTIPFPLLHIDTGWKFKEMYIFRDHIASTSNIELI 88  Buchnera aphidi...
AAD55760      24 LKALENEAIHIFREVAAEFERPVMLYSIGKDSSVLLHLARKAFYPGRIPFPLLHVDTGWKFREMIAFRDEMVAKYDLDLV 103 Sinorhizobium m...
P28603         8 LRLLEAESIAILRETAASFTKPVLLYSIGKDSGVLLHLARKAFHPSPVPFPLLHVDTGWKFREMIAFRDATVRRLGLTLI 87  Azospirillum br...
P52995         6 LRYLESEAIHIIREVAATFSNPVVLYSIGKDSSVLLHLAMKAFFPGKPPFPFLHVDTRWKFREMIDFRDRMMREMDLKLI 85  Rhizobium tropici
BAB96811      26 LDALESEAIHIFREVAGEFERPVILFSGGKDSTVLLHLAIKAFWPAPLPFTLLHVDTGHNLQEVLDFRDHVVAKYNLRLH 105 Rhodococcus ery...
Q10599        19 LRLLEAEAIHVIREVAAEFERPVLLFSGGKDSIVMLHLALKAFRPGRLPFPVMHVDTGHNFDEVIATRDELVAAAGVRLV 98  Mycobacterium t...
WP_032309065   9 LRQLEAESIHIIREVAAEFSNPVMLYSIGKDSSVMLHLARKAFYPGTLPFPLLHVDTGWKFREMYEFRDRTAKAYGCELL 88  Escherichia coli
P57499        89 VHSHSKGKLLGLNPFENGGSKYTDIMKTEGLKEAINKYNFDAAFGGARRDEEKSRSKERIYSFRDSLHQWDPKKQRPELW 168 Buchnera aphidi...
AAD55760     104 AHTNPRGAAENVTPFTHGSALYTDIMKTEALRQALDAGQYDAAFGGARRDEEASRAKERIYSFRTPDHRWDPRNQRPELW 183 Sinorhizobium m...
P28603        88 VHRNEEGHARGIDPIRSGSALHTRVMKTEALRQALDRHGFDAAIGGARRDEEKSRAKERVFSIRNAAHAWDPRDQRPELW 167 Azospirillum br...
P52995        86 VHVNQDGIDQGISPFRDGSNVHTHMMKTMALRQALDKFSFDAALAGARREEEKSRAKERIFSIRNAQHAWDPKRQRPEMW 165 Rhizobium tropici
BAB96811     106 VASVEEYIADGR--LTERPDGIRNPLQTVPLLDAISENRFDAVFGGARRDEERARAKERIFSLRNAFGQWDPKKQRPELW 183 Rhodococcus ery...
Q10599        99 VASVQDDIDAGR--VVETIP-SRNPIQTVTLLRAIRENQFDAAFGGARRDEEKARAKERVFSFRDEFGQWDPKAQRPELW 175 Mycobacterium t...
WP_032309065  89 VHKNPEGVAMGINPFVHGSAKHTDIMKTEGLKQALNKYGFDAAFGGARRDEEKSRAKERIYSFRDRFHRWDPKNQRPELW 168 Escherichia coli
P57499       169 WNYNGQINKGENIRVFPLSNWTELDIWQYIFLEKIEIVPLYFAAKRPVLERNGVLTVIDDSRMKIKSNEVIKEKMVRFRT 248 Buchnera aphidi...
AAD55760     184 NVYNGMIRKGESVRAFPLSNWTEVDIWRYIQAEDIPIVPLYFAKKRPVVERDGMLILAEDPRLELLPGEVKREEVIAFRT 263 Sinorhizobium m...
P28603       168 RLWNPRIQPGESVRVFPLSNWTELDVWRYVAAQSIPVVPLYFAAERPVVHRSGALIMVDDGRLPLNPGETPEMRRVRFRT 247 Azospirillum br...
P52995       166 RTYNTRVSAGETMRVFPLSNWTELDVWEYNQKENIPVVPLYFAAPRPVVQRGAGMIMVDDERMPLEPDETVTQRMIRFRT 245 Rhizobium tropici
BAB96811     184 NLYNGRHSPGEQVRVFPLSNFTELDIWRYIARDNVELASIYYAHQRPVYQRDGMWMTPG-VWGGPADGEELQTLSVRYRT 262 Rhodococcus ery...
Q10599       176 NLYNGRHHKGEHIRVFPLSNWTEFDIWSYIGAEQVRLPSIYFAHRRKVFQRDGMLLAVH-RHMQPRADEPVFEATVRFRT 254 Mycobacterium t...
WP_032309065 169 HNYNGQINKGESIRVFPLSNWTEQDIWQYIWLENIDIVPLYLAAERPVLERDGMLMMIDDNRIDLQPGEVIKKRMVRFRT 248 Escherichia coli
P57499       249 LGCWPLTNAIESEARNVEDIIKETLIVKTSER-TGRAIDYDQKSSMEFKKRQGYF 302 Buchnera aphidicola str. APS (Acyrthosip...
AAD55760     264 LGCFPLTGAIRSEADTLDDIIAELETATVSER-QGRAIDRDQAGSMEKKKREGYF 317 Sinorhizobium meliloti
P28603       248 LGCYPLSGAIDSDAATVEDIIVEMRASRTSER-QGRLIDGDEPASMERKKREGYF 301 Azospirillum brasilense
P52995       246 LGCYPLTGAIESSAETVPEILREIVEARTSER-QSRLIDFDEAGAMEKKKREGYF 299 Rhizobium tropici
BAB96811     263 VGDGSTTGAVLSDAADNEAILAEVAASRLTERgATRGDDRVSEAAMEDRKREGYF 317 Rhodococcus erythropolis
Q10599       255 VGDVTCTGCVESSASTVAEVIAETAVARLTERgATRADDRISEAGMEDRKRQGYF 309 Mycobacterium tuberculosis
WP_032309065 249 LGCWPLTGAVESNAQTLPEIIEEMLVSTTSER-QGRVIDRDQAGSMELKKRQGYF 302 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap