Conserved Protein Domain Family
dsdC

?
TIGR02036: dsdC 
D-serine deaminase transcriptional activator
This family, part of the LysR family of transcriptional regulators, activates transcription of the gene for D-serine deaminase, dsdA. Trusted members of this family so far are found adjacent to dsdA and only in Gammaproteobacteria, including E. coli, Vibrio cholerae, and Colwellia psychrerythraea. [Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 131091
View PSSM: TIGR02036
Aligned: 3 rows
Threshold Bit Score: 598.036
Threshold Setting Gi: 446210261
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P46068         8 RNRLLNGWQLSKMHTFEVAARHQSFALAAEELSLSPSAVSHRINQLEEELGIQLFVRSHRKVELTHEGKRVYWALKSSLD 87  Escherichia col...
WP_011045383  10 NNKRLSSFQLSKMHTFEVAARHCSFSLAAEELSMTPSAISHRINALESELGILLFKRSHRKIELTKEGERIYIAVKSSFS 89  Colwellia psych...
WP_000288116  10 KHSRINSFQLSKLHTFEVAARHNSFSLAADELSLTPSAISHRINKLEEEIGIKLFERTHRKVVLTEEGQRIYHSLQKTLN 89  Vibrio cholerae
P46068        88 TLNQEILDIKNQELSGTLTLYSRPSIAQCWLVPALGDFTRRYPSISLTVLTGNDNVNLQRAGIDLAIYFDDAPSAQLTHH 167 Escherichia col...
WP_011045383  90 SLNQEILEVKSNEISGELTVYSRPSFAQCWLVPRIAGFQKQYPAISLNILTGNENINFHGHGIDVAIYFDEKQPSKLYCQ 169 Colwellia psych...
WP_000288116  90 NLNQEITDIKNGETSGLLTIYSRPSFAQCWLVPRIHAFKELYPSIDLKLLTGNENISFQGSGIDVAIYFDDHMPDKLSCK 169 Vibrio cholerae
P46068       168 FLMDEEILPVCSPEYAQRHALTNTVINLCHCTLLHDRQAWSNDSGTDEWHSWAQHYAVN-LPTSSGIGFDRSDLAVIAAM 246 Escherichia col...
WP_011045383 170 DIMTETIVPVCSPEYAEEFDLIGKINNLSQCTLLHDNQAWGYDSNTDEWALWANNFNINcLASSASIRFDRSDLAVIAAM 249 Colwellia psych...
WP_000288116 170 EIFSETIIPVCTPEYAQKYSLTSSMDNLYNTTLLHDNQAWNYNSDADEWKTWANANQLEnLENISRIGFDRSDLAVIAAI 249 Vibrio cholerae
P46068       247 NHIGVAMGRKRLVQKRLASGELVAPFGDMTVKCHQHYYITTLPGRQWPKIEAFIIWLREQVK 308 Escherichia coli K-12
WP_011045383 250 NNAGVAMGRESFISNQIKRGELIKPFIDKKILCPQRYYVATLPNNKNTKIELFIEWLKNEVQ 311 Colwellia psychrerythraea
WP_000288116 250 NNAGIAMGRFSLVKSRLSSGELMTPYPNTEVICKQRYYVATLPNKHNQKVKLFIDWLESQVK 311 Vibrio cholerae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap