Conserved Protein Domain Family
BchI-ChlI

?
TIGR02030: BchI-ChlI 
magnesium chelatase ATPase subunit I
This model represents one of two ATPase subunits of the trimeric magnesium chelatase responsible for insertion of magnesium ion into protoporphyrin IX. This is an essential step in the biosynthesis of both chlorophyll and bacteriochlorophyll. This subunit is found in green plants, photosynthetic algae, cyanobacteria and other photosynthetic bacteria. [Biosynthesis of cofactors, prosthetic groups, and carriers, Chlorophyll and bacteriochlorphyll]
Statistics
?
PSSM-Id: 131085
View PSSM: TIGR02030
Aligned: 3 rows
Threshold Bit Score: 561.43
Threshold Setting Gi: 6690719
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAG15216  30 YPFVAIVGQAELKLALLLCVVNPTIGGVMVMGHRGTAKSTAVRALAAMLPPIKAVAGCPYSCAPDRTAGLCDQCRALEQQ 109 Chloroflexus aurant...
P51634    16 FPFTAIVGQDEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIEVVANDPFNSSPSDPEMMSEEVRIRVDS 95  Synechocystis sp. P...
AAF24287   5 FPFSAIVGQEQMKQAMVLTAIDPGIGGVLVFGDRGTGKSTAVRALAALLPLIKAVEGCPVN---SARPEDCPEWAHVSST 81  Rhodobacter sphaero...
AAG15216 110 SgktKKPAVINIPVPVVDLPLGATEDRVCGTLDIERALTQGVQAFAPGLLARANRGFLYIDEVNLLEDHLVDVLLDVAAS 189 Chloroflexus aurant...
P51634    96 Q---EPLSIVKKKVTMVDLPLGATEDRVCGTIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAAG 172 Synechocystis sp. P...
AAF24287  82 -------TMIERPTPVVDLPLGVTEDRVVGALDIQRALTRGEKAFEPGLLARANRGYLYIDEVNLLEDHIVDLLLDVAQS 154 Rhodobacter sphaero...
AAG15216 190 GVNVVEREGVSVRHPARFVLVGSGNPEEGDLRPQLLDRFGLHARITTITDVSERVEIVKRRREYDADPFAFVEKWAKETQ 269 Chloroflexus aurant...
P51634   173 GWNTVEREGISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVREPELRVKIVEQRTEFDQNPHPFCDQYQTEQE 252 Synechocystis sp. P...
AAF24287 155 GENVVEREGLSIRHPARFVLVGSGNPEEGELRPQLLDRFGLSVEVRSPRDVETRVEVITRRDAYDADHDAFMEKWGAEDM 234 Rhodobacter sphaero...
AAG15216 270 KLQRKIKQAQRRLPEVILPDPVLYKIAELCVKLEVDGHRGELTLARAATALAALEGRNEVTVQDVRRIAVLALRHRLRKD 349 Chloroflexus aurant...
P51634   253 ALQAKIVNAQNLLPQVTIDYDYRVKVSEVCAELDVDGLRGDIVTNRAAKALAAFEGRTEVTVDDISRVIVLCLRHRLRKD 332 Synechocystis sp. P...
AAF24287 235 QLRGRILGARAALPQLKTPNTVLHDCAALCIALGSDGLRGELTLLRAARAQAAFEGAEAVGRSHLRSVATMALSHRLRRD 314 Rhodobacter sphaero...
AAG15216 350 PLETQDDAVRIERAVEEVLV 369 Chloroflexus aurantiacus
P51634   333 PLESIDSGSKVEKVFKRVFG 352 Synechocystis sp. PCC 6803 substr. Kazusa
AAF24287 315 PLDEAGSVSRVERCVAEVLP 334 Rhodobacter sphaeroides
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap