Conserved Protein Domain Family
ChlP

?
TIGR02028: ChlP 
geranylgeranyl reductase
This model represents the reductase which acts reduces the geranylgeranyl group to the phytyl group in the side chain of chlorophyll. It is unclear whether the enzyme has a preference for acting before or after the attachment of the side chain to chlorophyllide a by chlorophyll synthase. This clade is restricted to plants and cyanobacteria to separate it from the homologues which act in the biosynthesis of bacteriochlorophyll. [Biosynthesis of cofactors, prosthetic groups, and carriers, Chlorophyll and bacteriochlorphyll]
Statistics
?
PSSM-Id: 131083
View PSSM: TIGR02028
Aligned: 3 rows
Threshold Bit Score: 703.588
Threshold Setting Gi: 6815059
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAA90346      33 LRVAVVGGGPAGASAAEALASAGAQAFLLERNPSGAKPCGGAIPLCMLDEFAIPRDLVDRRVTRMRVLSPSNLAADFSRA 112 Oryza sativa (j...
CAA74372      61 LRVAVIGGGPAGGAAAETLAQGGIETILIERKMDNCKPCGGAIPLCMVGEFNLPLDIIDRRVTKMKMISPSNIAVDIGRT 140 thale cress
WP_011056005   3 LRVAVVGGGPAGSSAAETLAKAGIQTYLFERKLDNAKPCGGAIPLCMVSEFDLPPEIIDRRVRKMKMISPSNIEVNIGHT 82  Thermosynechoco...
BAA90346     113 LPPGAHIPMLRREVLDSFLRRRAADAGATLVPGLVTSLSLPADpATDPYLVHYISSD-SGGPSSSRCVLEVDAVIGADGA 191 Oryza sativa (j...
CAA74372     141 LKEHEYIGMVRREVLDAYLRERAEKSGATVINGLFLKMDHPEN-WDSPYTLHYTEYDgKTGATGTKKTMEVDAVIGADGA 219 thale cress
WP_011056005  83 LKEHEYIGMCRREVLDSFMRNRAADLGANLINGTVFKLEQPTT-SDRPYTLHYVQED------GTAQTLEVDVVIGADGA 155 Thermosynechoco...
BAA90346     192 NSRVAREVGAGDYSTAIAFQERIRLPDEAMAYYDDLAEMYVGGDVSPDFYGWVFPKCDHVAVGTGTV-AAKPEIKRLQSG 270 Oryza sativa (j...
CAA74372     220 NSRVAKSIDAGDYDYAIAFQERIRIPDEKMTYYEDLAEMYVGDDVSPDFYGWVFPKCDHVAVGTGTV-THKGDIKKFQLA 298 thale cress
WP_011056005 156 NSRIAKEIDAGDYNYAIAYQERIRLPEDKMAYYNELAEMYVGDDVSPDFYAWVFPKYDHVAVGTGTMkVNKDRIRELQAG 235 Thermosynechoco...
BAA90346     271 IRARAAGKVAGGRVVRVEAHPIPEHPRPRRVVGRVALVGDAAGYVTRCSGEGIYFAARSGRLCGRAMADEWRLTGAVTEA 350 Oryza sativa (j...
CAA74372     299 TRNRAKDKILGGKIIRVEAHPIPEHPRPRRLSKRVALVGDAAGYVTKCSGEGIYFAAKSGRMCAEAIVEGSQNGKKMIDE 378 thale cress
WP_011056005 236 IRSRAAAKLEGGQIIKVEAHPIPEHPRPRRVVGRVALVGDAAGTVTKSSGEGIYFAAKSARMCAETIVETSNGGRRIPTE 315 Thermosynechoco...
BAA90346     351 GIRAGYLRRWDDEFRPTFRFLDLLQRVFYGGNAGREALVEMCADEHVQRRTFDSYLHKRMAPAEPWGDLRLLWRTAAAMV 430 Oryza sativa (j...
CAA74372     379 GDLRKYLEKWDKTYLPTYRVLDVLQKVFYRSNPAREAFVEMCNDEYVQKMTFDSYLYKRVAPGSPLEDIKLAVNTIGSLV 458 thale cress
WP_011056005 316 ADLKLYLKRWDKAYGMTYLVLDLLQRVFYRSDATREAFVEMCSDLDVQKLTFDSYLYKTVVPANPLVQLKITAKTIGSLM 395 Thermosynechoco...
BAA90346     431 R 431 Oryza sativa (japonica cultivar-group)
CAA74372     459 R 459 thale cress
WP_011056005 396 R 396 Thermosynechococcus elongatus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap