Conserved Protein Domain Family
BchE

?
TIGR02026: BchE 
magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase
This model represents the cobalamin-dependent oxidative cyclase, a radical SAM enzyme responsible for forming the distinctive E-ring of the chlorin ring system under anaerobic conditions. This step is essential in the biosynthesis of both bacteriochlorophyll and chlorophyll under anaerobic conditions (a separate enzyme, AcsF, acts under aerobic conditions). This model identifies two clades of sequences, one from photosynthetic, non-cyanobacterial bacteria and another including Synechocystis and several non-photosynthetic bacteria. The function of the Synechocystis gene is supported by gene clustering with other photosynthetic genes, so the purpose of the gene in the non-photosynthetic bacteria is uncertain. Note that homologs of this gene are not found in plants which rely solely on the aerobic cyclase.
Statistics
?
PSSM-Id: 131081
View PSSM: TIGR02026
Aligned: 3 rows
Threshold Bit Score: 795.269
Threshold Setting Gi: 499176097
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9RFD3         2 RIVFVHPNYHSGGAEIAG-SWPPAWVAYLCGALKKAGYTDYHFIDAMTDYVSHEKLAEKLRELQPDIVAT--TAITPSIY 78  Rhodobacter sph...
AAG15204       2 RIMMIQPNYHAGGAEIAG-NWPPSWVAYIGGALRAAGFDNLRFVDAMTEDLPDEKLRLILRHNRPDVVMA--TAITPMIY 78  Chloroflexus au...
WP_010873684   2 RILILNPPHPAIGSRIPKeQLPPLGLLSIGGPLLDAG-HDVTLLDAEFGPLTDSEIVERVCAHCPQLLLIghSGSTSAHP 80  Synechocystis s...
Q9RFD3        79 VAEETLKVAMEVVPNALRVLGGIHATFMFRQVLEEAPWIDVIVRGEGEEVLVNLVKAYEADNFAETRRQVKGLAFLDG-D 157 Rhodobacter sph...
AAG15204      79 KAQETLKIAREELPNARLILGGIHPTFMYGQVLTEAPWIDYIVRGEGEEIIVELMQAIAYGSDQRDRVKIRGIAYLED-G 157 Chloroflexus au...
WP_010873684  81 IVCRLTLFLRERLPNLIIVYGGVFPTYHFHDILTKEPQIDFIVRGEGEATVAKLIAALENHN---DLNKVDGIAFRRDeQ 157 Synechocystis s...
Q9RFD3       158 EIVSTAAAPTIRDVDSIDPDWGIINWKNYIYEPLGVRVAIPNMARGCPFTCSFCSQWKFWRDYRVRDPKKVVDEIEKLVN 237 Rhodobacter sph...
AAG15204     158 KVVATPARDPIADLDKLTPDWSLYDWKRYIYVPLNVRVAVPNFARGCPFTCRFCSQWKFWRRYRARSPQKFVDEIETLVR 237 Chloroflexus au...
WP_010873684 158 -IIETLPAPMIQDLDVYRVGWELVDLKKYSYYG-GKQAVVIQFSRGCPHLCNYCGQRGFWARWRHRDPKKFAQEIVWLHR 235 Synechocystis s...
Q9RFD3       238 EHGVGFFILADEEPTINRKKFIEFCEEMIARglPDKVKWGINTRVTDVKRDKELLKFYRKAGLVHISLGTEAAAQLKLDV 317 Rhodobacter sph...
AAG15204     238 DYNVGFFILADEEPTINRKKFTALCEELIRR--QVRVYWGINTRVTDILRDEAQLPLWRAAGLVHISLGTEAAAQMNLDR 315 Chloroflexus au...
WP_010873684 236 THGVQLFNLADENPTVNKAIWQEFCEAIIAEn--ISITIIGSTRADDIVRDADILHLYRRAGVERFLLGMENTNEATLKH 313 Synechocystis s...
Q9RFD3       318 FNKETTVAENKEAIRLLREADIFTEAQFIVGLDNETKETLEETYRMAWDWQPDLANWSMYTPWPFTPLFQELRDQVEVF- 396 Rhodobacter sph...
AAG15204     316 FRKQTTIEQNKRAIELIKKHGMVAEAQFIMGMENETPETIEETYRYVLDWKPDMANWNMYTPWPFAELFEELGDRVEVR- 394 Chloroflexus au...
WP_010873684 314 IRKGSKTSTDREAIRLLRQHNILSLATWVTDFEEVRDRDFIQALKQLLYYDPDQIMSLYVTPHRWTSFYGIASERRVIQl 393 Synechocystis s...
Q9RFD3       397 DYSKYNFVTPIMKPKALTRGELLDGVMNNYRRFYMK-KALFHYPWRGTGFRRRYLLGCLKAFLKAGVGRTFYDLGKAGYW 475 Rhodobacter sph...
AAG15204     395 DYAKYNFVTPIMKPDLMDREEVLKGVLRNYARFYMR-KAFLEYPFIKDPFKRRYMLGCLRAFMKTTVTRRFYDLGRVHVR 473 Chloroflexus au...
WP_010873684 394 DQTKWDYKHQVLAATHMPPWRIFLWVKLIEILLQTRpKALWRLLFQPNKASRRGMY-------------WFTLMGRRVLV 460 Synechocystis s...
Q9RFD3       476 GpqSKDKVDFHFDETRKIGNAQMADW 501 Rhodobacter sphaeroides 2.4.1
AAG15204     474 G--TQLEIDLGFDESRVLTPEQIAAL 497 Chloroflexus aurantiacus
WP_010873684 461 H----ELINFFFGDRRVKNGPTLQEF 482 Synechocystis sp. PCC 6803
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap