1TT9


Conserved Protein Domain Family
FtcD

?
TIGR02024: FtcD 
Click on image for an interactive view with Cn3D
glutamate formiminotransferase
This model represents the tetrahydrofolate (THF) dependent glutamate formiminotransferase involved in the histidine utilization pathway. This enzyme interconverts L-glutamate and N-formimino-L-glutamate. The enzyme is bifunctional as it also catalyzes the cyclodeaminase reaction on N-formimino-THF, converting it to 5,10-methenyl-THF and releasing ammonia - part of the process of regenerating THF. This model covers enzymes from metazoa as well as gram-positive bacteria and archaea. In humans, deficiency of this enzyme results in a disease phenotype. The crystal structure of the enzyme has been studied in the context of the catalytic mechanism. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 131079
View PSSM: TIGR02024
Aligned: 6 rows
Threshold Bit Score: 492.737
Threshold Setting Gi: 499204336
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1TT9_A         1 MSQLVECVPNFSEGNNQEVIDAISQAISQTPGCVLLDVDAGPSTNRTVYTFVGQPECVVEGALSAARTASQLIDXRKHKG 80  Norway rat
AAO36783       1 MARLVECVPNFSEGKDKKIIETIVDEVRKIENVKLLDYSSDEDHNRSVVTMIGDPEDVKKAVLGLAKKSIELIDMTKHHG 80  Clostridium tet...
WP_004080786   1 -MKLIESVPNFSEGRRKEVVEKIVAEAKKYDRVWVLDWSMDADHNRSVITLVGEPENLINALFDMTKKAAELIDLRNHTG 79  Thermotoga
WP_010901876   1 -MSLVECVPNFSEGRDRDRVNRIRDAIASVDTVKILDVEMDPNHNRSVITFVCDSSKAVDAAFAGIKAAAEIIDMDAHRG 79  Thermoplasma ac...
O95954         1 MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQG 80  human
WP_005903266   1 MNKILMAEVNISEGTNLELIEKVKKSFIDEKNIEIVDIDSNVDHNRTVFTYKGEPSAVLNATKKLAKCAVDLIDMRNHKG 80  Fusobacterium n...
1TT9_A        81 EHPRXGALDVCPFIPVRGVSXDECVLCAKAFGQRLAeELNVPVYLYGEAAQXPSRQTLPAIRAG--EYEALPEKLKQAEW 158 Norway rat
AAO36783      81 GHPRMGAVDVIPFTPVSDVTMEECVELANEVGKEIG-SLGVPVYLYEDAATTPERQNLAKVRKG--QYEGFFEKIKESEW 157 Clostridium tet...
WP_004080786  80 QHPRMGAADVIPLVPLYNTTMEECVEYSKILGRRIGeELGIPVYLYEKSATRPERQNLADIRKG--EFEGFFEKIKDPLW 157 Thermotoga
WP_010901876  80 EHPRFGAADVIPFVPLQDTKMETCVRLARDLGKRVGeELGIPVYLYAEAAQRPDRSDLAAIRNKnfQYEQLKEAIKEEKW 159 Thermoplasma ac...
O95954        81 EHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAeELDVPVYLYGEAARMDSRRTLPAIRAG--EYEALPKKLQQADW 158 human
WP_005903266  81 SHPRMGAVDVVPFIPVKNITTEEAVEIAKEFGKYLG-EQGVPVYFYEDAQEKEYRKTLPSIRKG--QYEALEEKMKDPKW 157 Fusobacterium n...
1TT9_A       159 VPDFGPSSFVPSWGATVTGARKFLIAFNINL-LSTKEQAHRIALNLREQGRGkdqpgrLKKVQGIGWYLEEKNLAQVSTN 237 Norway rat
AAO36783     158 KPDYGPQEMNAKSGCTAVGARVALVAFNVNLgTDNLEVADAIAKKVRFIGGG------LRFAKAIGLKLEERNIVQVSMN 231 Clostridium tet...
WP_004080786 158 KPDFGPDRVHPTAGVTAVGAREFLIAFNVNLgTRDVKIAEKIARAIRFSSGG------LRYVKAIGVDLKGRGVVQVSIN 231 Thermotoga
WP_010901876 160 KPDFGPSVVG-KAGASIIGARDFLIAYNVNLnTSNMEIGKKIASAIRAKDGG------LTFVKSLAFFLKDKNMVQISMN 232 Thermoplasma ac...
O95954       159 APDFGPSSFVPSWGATATGARKFLIAFNINL-LGTKEQAHRIALNLREQGRGkdqpgrLKKVQGIGWYLDEKNLAQVSTN 237 human
WP_005903266 158 APDEGPKEFNPKSGGTVTGARFPLVAFNINLdTYNLEIGKKIVKAVRSATGG------YSCIRAIALELEEKKQIQVSMN 231 Fusobacterium n...
1TT9_A       238 LLDFEVTALHTVYEEARREAQELNLPVVGSQLVGLVPLKALLDAAAFYCDkeklfvleeehrirlvvnrlgLDSlapFDP 317 Norway rat
AAO36783     232 LVNYEKTSVYRAFEMIKMEAKRYGVPVVGSEVIGTVPMKALLDCAEYYLQ---------------------IEN---FDI 287 Clostridium tet...
WP_004080786 232 ITNHKKTPLYRVFELIKMEAERYGVPVLGSEIVGLFPLESLLKTVSYYLR---------------------TD----LNA 286 Thermotoga
WP_010901876 233 LTNYRKTPIYRAYELVRLEAARYGVLPVESEIVGLVPEQALIDVAKYYLQ---------------------LNG---FDE 288 Thermoplasma ac...
O95954       238 LLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEkenlfileeeqrirlvvsrlgLDSlcpFSP 317 human
WP_005903266 232 MINYEKTPIHRVFETIKSEANRYNVNIVDTELVGPVPIYALRDVLDFYLRi--------------------ADS---FSL 288 Fusobacterium n...
1TT9_A       318 KeRIIEYLVPD 328 Norway rat
AAO36783     288 S-QILEKRLLD 297 Clostridium tetani E88
WP_004080786 287 K-KVIESNLLE 296 Thermotoga
WP_010901876 289 G-NILERKMEK 298 Thermoplasma acidophilum
O95954       318 KeRIIEYLVPE 328 human
WP_005903266 289 D-QIYF----- 293 Fusobacterium nucleatum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap